(data stored in SCRATCH3701 zone)

EMBL: AE017197.UVRB

AE017197.UVRB        Location/Qualifiers
FT   CDS_pept        complement(244545..246533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="RT0193"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:RT0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03677"
FT                   /db_xref="GOA:Q68XG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG5"
FT                   /protein_id="AAU03677.1"
FT                   /translation="MNNFSIISAYKPAGGQPKAIDEIIAGLNSKKRSQMLLGITGSGKT
FT                   FTMANIIERTNRPTLIMAHNKTLAAQIYLEMKSIFPKNAVEYFVSYYDYYQPEAYIVRT
FT                   DTFIEKDSSINEQIDLMRHSATRSLLERRDVIVIASVSCIYGLGAPDLYYQMTVHLELG
FT                   QSYPRDKLLNDLINLQYKRNDIGFERGCFRVKGDHIDIFPSHYSDKAWRLSFFGNELEY
FT                   IHEFDPLTGEKLTQLDKAMVFGNSHFVMPQKTINNAISSIEVELQKHLDVLKSQDKLIE
FT                   AKRLNQRTQYDLEMLTETGSCKGIENYSRFFTGRNAGEPPPTLFEYLPKDALLFLDESH
FT                   VSIPQIRAMYNSDRARKEVLVEHGFRLPSALDNRPLKFEEWEKFRPQTVFVSATPGPFE
FT                   LEETGGTVVELIIRPTGLLDPECIIKPATNQVEDLISEIQTTITKGLRILVTTLTKKMA
FT                   EDLTSYLQDLQYKTYYLHSNIHTLERIEILRDLRQGNIDILVGINLLREGIDIPECGLV
FT                   AILDADKEGFLRSEVSLIQTIGRAARNSRGKVILYADKMTKSIDKAVSETLRRRQIQQE
FT                   YNKKYGIIPKTINSAIHTLESLEEIHDNKLDKKQTNTLLNNPAKLKSYMDKLKKEMFKA
FT                   ASNLEFEQAAKLRNQLKTLEKAVLELS"
     atgaataatt tttctattat ctcagcatat aaaccagcag gcggtcaacc aaaagcaata        60
     gatgaaatta tagcagggtt aaatagtaaa aaacgctcac aaatgttgct tggtattaca       120
     ggatcaggta aaacttttac tatggcaaat attatagaaa gaactaatag acctactctt       180
     attatggctc ataataaaac tttagctgca caaatctatt tagaaatgaa atcaattttt       240
     ccaaagaatg cagttgaata ttttgtctca tattatgatt attatcagcc agaagcttat       300
     atagtacgca ctgatacttt catcgaaaaa gattcatcaa ttaatgaaca gattgattta       360
     atgcgtcatt ctgctacaag atcgttatta gaacgtcgtg atgtgatagt aattgcgtct       420
     gtttcgtgta tttatggact tggcgctcct gatttatatt atcagatgac tgtgcattta       480
     gaacttggtc aaagctatcc tcgtgataag ttactaaatg atttaataaa tctgcaatat       540
     aaacgtaatg atatcggatt tgagcgtggc tgttttaggg ttaaaggcga ccacattgat       600
     atttttccct cacattatag cgataaagct tggcgtttat catttttcgg taatgaactc       660
     gaatatattc atgaatttga cccattaaca ggtgagaaac ttactcagct tgataaagct       720
     atggtttttg gtaattcaca ctttgttatg ccacaaaaaa caataaataa tgcaatatca       780
     agcattgagg tagagttgca aaaacactta gatgtcttaa agtcacaaga taaactaatt       840
     gaagcgaaaa gactaaacca gcgtactcaa tatgatcttg aaatgttaac agaaacaggt       900
     agctgtaaag gaattgaaaa ctactctcgc tttttcacag gacgtaatgc cggtgagcct       960
     cctcctacat tattcgagta tttacctaaa gatgctttat tgtttcttga tgaaagccat      1020
     gtatcaatac cacaaattag agcgatgtat aacagcgatc gagcacgaaa agaagtgttg      1080
     gtagagcatg gatttcgttt accttctgca cttgataaca gacctttaaa atttgaagaa      1140
     tgggaaaaat ttagaccaca aactgtgttt gtatctgcaa ctccgggacc attcgaatta      1200
     gaagagacag gtggcactgt agtagagctg attatcagac ctacaggact tctagatcct      1260
     gaatgtatta tcaaaccagc tactaaccaa gttgaggatt taattagcga aattcaaaca      1320
     actatcacta aaggtttacg tatcttagtc actacattaa caaaaaaaat ggctgaagat      1380
     ttaacatcct atttgcagga tctgcaatat aaaacatatt atttgcattc caatatacat      1440
     actctagaac gtattgaaat attaagagat ttaagacaag gtaatatcga tattttagta      1500
     ggtattaatc tattaagaga ggggattgat attcctgagt gcggtttagt tgcgatactt      1560
     gatgcagaca aagagggatt tttacgatct gaagtatcac taatacaaac aataggaaga      1620
     gctgcaagaa atagtagagg taaagttata ctttatgcag ataaaatgac taaatctata      1680
     gataaagctg ttagtgaaac attacgtaga agacaaattc aacaggaata taataaaaaa      1740
     tatggtataa ttccaaaaac tatcaatagt gctattcata ctttagaatc acttgaagaa      1800
     atccatgata ataaactcga taaaaaacaa actaatactt tattgaataa tcctgctaaa      1860
     ctaaaatctt acatggataa attaaaaaaa gaaatgttta aagctgcaag taatcttgaa      1920
     tttgaacaag ctgcaaaact ccgtaaccaa ctcaaaactc tagaaaaggc agtactggag      1980
     ttaagctaa                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page