(data stored in SCRATCH3701 zone)

EMBL: AE017197.VIRB10

AE017197.VIRB10      Location/Qualifiers
FT   CDS_pept        354946..356397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="RT0282"
FT                   /product="VirB10 protein of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03762"
FT                   /db_xref="GOA:Q68X80"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X80"
FT                   /protein_id="AAU03762.1"
FT                   /translation="MVAEQNNNNNTDSLSGTDLPEVQRELSKVSVSFNKNIAIVVVICA
FT                   ILIYIFYTLFFDMRKEEIPETKIPSNIVTPVTDVNDIIPEIPKLPDPPKLERPTVLQPP
FT                   PPPPPVVEVPPVLPPISIEGNKEQTLQLPPVSLPTTSSTLVESDAEKQRREAKRKSAIV
FT                   LVGGVEPKKTPEQITEAVTFKDRGDMFLLLGRGKLIDAVLETGINSDLGGEIRAIISRD
FT                   VFSEKGKVILIPKGSKIFGKYATSTSSDSYGRVSIIWDRVDLTNGYTIEFDSPAVDNLG
FT                   RPGLQGRVDNKYKEQFANAVLQSGFNIGLAKILDKLVPPPIDSQAAATNSATATQILNI
FT                   AQTISSNTAIDVNTRIVTICTNILAAITDKTSIAYTTMTQACATAQNASSANTSEQRLQ
FT                   TLVQAVNTAASNLLTTTSIASTPTQAQQASTQAFTDVTNVVQNMITQQHFKPTTTVNQG
FT                   TPIRIYVNKDYKFPRTVLLKSKVMK"
     atggttgcag agcaaaataa caataataat accgattctt tatcaggtac agacttacct        60
     gaggtacaaa gggaattatc taaagtttcg gttagtttta ataagaatat tgcaatagta       120
     gtggtaattt gtgctattct tatatatatc ttttatactc ttttttttga catgagaaaa       180
     gaagaaatac ctgagactaa gataccgagt aatattgtaa cgcctgttac ggatgttaat       240
     gatattattc cagagatccc aaagttacca gatccaccta aacttgagag gccaacagtg       300
     cttcaaccac cgcctcctcc tccgccagta gtagaagttc cgcctgtttt acctccgatt       360
     tctatagaag ggaataaaga gcagacactt caattgccac cggtgtcgtt acctacgacc       420
     tcatcaacgt tagttgagag tgatgcagag aagcaacgcc gtgaagcaaa acggaaatca       480
     gctatagtgt tagtgggtgg tgtagagcct aaaaaaacac cagaacaaat tacagaagcg       540
     gtgacattta aagatcgtgg tgatatgttt ttgttgcttg gacgcggtaa gttaatcgat       600
     gcagtgcttg agacaggaat aaatagtgat ctcggtggtg aaataagggc aattattagt       660
     agagacgtat tttctgaaaa aggtaaagtg atattaatac caaaagggtc aaaaatattc       720
     ggtaaatatg caacttcaac ttcatcagat agttacggta gggtttctat catatgggat       780
     cgagtcgatt taactaatgg ttataccata gaatttgact cacctgcagt tgataatttg       840
     ggtagacctg gattacaggg gagggttgat aataaatata aggaacaatt tgcaaatgcc       900
     gtattacaat ctggctttaa tataggtctt gctaaaatcc tagataagtt agtcccacct       960
     cctatagatt cacaagcagc ggctaccaac agtgctacag caacacaaat attaaatata      1020
     gctcaaacta tttcgtctaa tactgctatt gatgtaaata ctaggatagt tacaatttgt      1080
     actaatatac ttgctgctat tactgataaa acttctattg cttatactac tatgactcaa      1140
     gcatgtgcga cagcacaaaa tgcttcttca gccaatactt ctgaacagag acttcaaaca      1200
     ttagtacagg cagttaatac agcagcttca aatttgctta ctactacatc tattgcctcg      1260
     actcctacac aagcacaaca agcttctacg caagctttta ctgatgtgac taatgttgta      1320
     caaaatatga taactcaaca gcattttaag cctacgacaa cggttaatca aggtacaccg      1380
     attagaatat atgttaataa ggattataaa tttccaagaa ccgttttatt aaaatcgaag      1440
     gtaatgaaat ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page