(data stored in SCRATCH3701 zone)

EMBL: AE017197.VIRB3

AE017197.VIRB3       Location/Qualifiers
FT   CDS_pept        complement(47136..47423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="RT0034"
FT                   /product="probable type IV secretory system protein VirB3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03522"
FT                   /db_xref="GOA:Q68XX0"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XX0"
FT                   /protein_id="AAU03522.1"
FT                   /translation="MSGTLASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGI
FT                   MILFIAGALHLVAYIICFKEPRFIELYLNKMSRTSQCPNKFYYGANSYNI"
     atgtcaggaa cattagcatc tgatctttta tttgtaggtt taactagacc gccgatgata        60
     tttggagtaa gtattaaatt tgcagcgtta aatatgataa tgactatgat agtatttatt       120
     tggaataacg gcattatgat tttattcatt gccggtgctt tgcatttggt agcttatatt       180
     atatgtttta aagagcctag atttatagag ctatatttaa ataaaatgtc aagaactagc       240
     caatgtccta ataaatttta ctacggagca aattcgtata atatttga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page