(data stored in SCRATCH3701 zone)

EMBL: AE017197.VIRB4A

AE017197.VIRB4A      Location/Qualifiers
FT   CDS_pept        complement(44546..46963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4a"
FT                   /locus_tag="RT0033"
FT                   /product="VirB4 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03521"
FT                   /db_xref="GOA:Q68XX1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XX1"
FT                   /protein_id="AAU03521.1"
FT                   /translation="MKLFRTRTAKELRSKQERPTSHFIPYRCHWDSNTILTKDNSLLQV
FT                   IKINGFSFETADDEDLDIKKNIRNALLKNMASGNIVMYFHTIRRRKAVIFDDTEFTYDP
FT                   TVKVPNDFITYLGAEWRKKHAGAKSFFNELYISILYKPDTGGAAIVEYFLKKLRQKSNK
FT                   TAWENDMKEMKENLQEMSTRVINTFRSYGAKLLGVRQTQSGIYCEILEFLSSLINCGDS
FT                   PGPIALPRGTIDEYLPTHRLFFDSRTIEVRSPFGKKYAGIISILEYGPNTSAGIFDGFL
FT                   QMPFEFVMTQSFVFANRTVAIGKMKLQQNRMIQSGDKATSQIVEINTALDMATSGDIGF
FT                   GDHHLSLLCSAKNIKALEDILSMAAVELSNSGIQPVREKVNMEPSYWGQLPGNMDYIVR
FT                   KSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIG
FT                   PTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLH
FT                   LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFRLEKKDRRLSNVIAFLG
FT                   IDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQRARVFGFDMTELLKDPVSLAPVLLY
FT                   IFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAA
FT                   KSSISDTLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLIKQGIDA
FT                   VVAKVNLEGMDNIISVLSGRVETVILLDQIRDKYGNDPDKWLPIFYEAVKTL"
     atgaagttat ttagaactag aacagctaaa gaattaaggt ctaaacaaga aagaccaact        60
     tcgcatttta tcccttatag gtgtcattgg gatagtaata ctattttaac aaaagataat       120
     tctttattac aagttattaa aatcaatgga ttttcttttg aaactgccga tgatgaagat       180
     ttagacatta aaaagaatat cagaaatgcc ttgcttaaaa atatggcttc tggaaacatt       240
     gttatgtatt tccatactat tagaagacgt aaagcagtaa tatttgacga tacagaattt       300
     acttatgatc ctaccgtaaa agtacctaat gattttatta cttatttagg tgcagagtgg       360
     cgtaagaaac atgcaggtgc taaatcattt tttaatgaat tatatattag tattttatat       420
     aagcctgata ctggcggtgc tgctatagtt gagtattttt taaagaagct tagacagaaa       480
     tctaataaaa ctgcttggga aaatgacatg aaagagatga aagaaaatct tcaagaaatg       540
     tcaacgagag tgattaatac attcagaagt tatggagcaa aattacttgg agtccgtcaa       600
     acacagtcag gtatctattg tgaaatttta gaatttcttt catctttaat taattgcggt       660
     gattcaccag gacctatagc attaccgcgt ggtactattg atgaatattt accaacacat       720
     agattatttt ttgattctcg tactattgaa gtcagaagtc cttttggcaa gaaatatgct       780
     ggcatcatca gtatacttga atacggtcct aatacttctg cgggaatttt tgatggattt       840
     ctacaaatgc cttttgaatt tgttatgact caaagctttg tatttgctaa tagaactgta       900
     gcaattggta aaatgaaatt acagcaaaat agaatgatac aatccggtga taaggcgact       960
     tcacaaattg ttgaaatcaa tacagcactt gatatggcta ctagcggtga tattggtttt      1020
     ggagatcatc atttatcact tttatgttcc gcaaagaata ttaaagcttt agaagatata      1080
     ttatcaatgg cagcagttga gctttctaat tcaggaattc agccggtgag agaaaaagtg      1140
     aacatggaac ctagctattg gggtcaatta cctggaaata tggattatat agtgcgtaaa      1200
     tcgactataa atactcttaa tatggctagc tttgcttcgc aacataatta tccactcggt      1260
     aaaattagag ataaccattg gggagaatat gtcacagtgc ttgatacaac ttcaggtaca      1320
     ccgttttatt ttaattttca tgttagagat gtgggacata ctctaattat aggtccaacg      1380
     ggtgccggta aaacagtgct tatgaacttc ttatgtgctg aagcacaaaa attcaaacct      1440
     cgtatgttct tttttgataa agatcgcgga gcagaaatat ttatacgtgc tttaaatgga      1500
     gtttatacag taattgatcc tggtttaaaa tgcaacttta atcctttgca tcttgaagat      1560
     actagtgaga atagaacgtt tattttagaa tggcttcgcg tacttgtaac ttctaacggt      1620
     gaaagtttaa ctgcacaaga taataaaatc ttatcacaag ctgtaagtgg caattttaga      1680
     ttagaaaaaa aagacagaag gcttagtaac gttattgcat tccttggtat tgatacacca      1740
     aatagtttag caagtaggat tgcaatgtgg gttggtaaag gttcacacgc taagatattt      1800
     gataatgaaa tagatgatat cgatttacaa agagcaaggg tatttggttt tgatatgacg      1860
     gaattactta aagatcctgt aagtcttgca ccggtattgt tatatatttt tcatcgtatt      1920
     aatatatctt tagatggaca aaaaacgatg atagtacttg atgaagcatg ggctttaatt      1980
     gacaatccag tatttgcgcc taagatcaaa gattggttaa aagtgttgag aaaattaaat      2040
     acttttgtta tatttgctac gcagagtgta gaagatgctg caaaaagtag tattagtgat      2100
     acgttgattc aacaaacagc cacacagatt tttttaccta atttaaaagc tacggatatt      2160
     tatcgtagtg catttatgtt aagtcagcgc gaatatattt taattaaaac taccgatcct      2220
     actacacgtt attttttaat aaaacaagga atagatgccg tagttgcgaa agttaactta      2280
     gaaggtatgg ataatataat tagtgtttta tctggcagag ttgaaactgt aatattgctt      2340
     gatcaaatta gagataaata cggcaatgat ccggataagt ggttacctat attttatgaa      2400
     gcagttaaaa cattatag                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page