(data stored in SCRATCH3701 zone)

EMBL: AE017197.VIRD4

AE017197.VIRD4       Location/Qualifiers
FT   CDS_pept        357721..359496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virD4"
FT                   /locus_tag="RT0284"
FT                   /product="VirD4 protein of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03764"
FT                   /db_xref="GOA:Q68X78"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X78"
FT                   /protein_id="AAU03764.1"
FT                   /translation="MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGVFIAIFTNEIGAL
FT                   GADINAINITYKWAYWLINVWRQLKIADYNYLKLKLIISLLGPAIIVIIFYIKNFQRIK
FT                   SLQFFEQPEKVYGDASWANQSDIEAAGLRSKKGMLIGVDAGGYFVADGFQHALLFAPTG
FT                   SGKGVGFVIPNLLFWTDSVVVHDIKLENHNLTSGWREKQGQKVFVWEPSNPDGITHCYN
FT                   PIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEVV
FT                   RTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANP
FT                   LIDSATASSDFNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKE
FT                   EPYGVMFLLDEFPTLGKMDTFKAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLS
FT                   NSTYRITFAANNYETANLISQLVGNKTVEQRSFSKPLFFDLNISTRTQNVSQVQRALLL
FT                   PQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPTFVPTQVPFNHVSNNSD
FT                   ASKETETTTAIENNE"
     atggaatggc ataagatact taaagttact aggaatatat tcggtcatgc tataattcat        60
     ccggttgtta ttttttgcac catttggatc agtggtgtgt ttattgcaat ttttactaat       120
     gagatcggag ctttaggtgc agacatcaat gctataaata ttacttataa gtgggcttac       180
     tggcttatta atgtttggcg gcaattaaaa attgccgatt ataattattt gaaattgaag       240
     ctaattatat ctcttcttgg tcctgctatt attgttataa tattttatat taaaaatttt       300
     caaagaataa aatcattaca attttttgag cagcctgaaa aagtatatgg tgacgctagt       360
     tgggctaatc agtctgatat agaagctgct ggtcttagat caaaaaaagg catgttaata       420
     ggtgttgatg ctggtggata ttttgttgca gatgggtttc agcatgcttt attattcgca       480
     cctaccggtt caggtaaagg tgttggtttt gtaataccta accttttatt ttggactgat       540
     tcagtagtag tacatgatat aaagcttgaa aatcacaatt tgactagtgg ttggcgtgag       600
     aaacaagggc aaaaagtttt tgtttgggaa ccttctaatc cagatggtat tacacattgt       660
     tataatccga ttgattgggt tagtactaag cctgggcaaa tggttgatga tgtacagaaa       720
     atttcgaatc ttataatgcc agaaaaggat ttttggaaca atgaagcacg tagtttattc       780
     ttaggcgtaa ctttatattt aatagctgat cctactaaaa ctaaatcttt cggtgaagta       840
     gtacgtacaa tgagaagtga cgatgtagtt tataatctag ccgttgtact tgatacgctt       900
     ggtggtgtaa tacatcctgt tgcatatatg aatattgctg catttttgca aaaagctgat       960
     aaagagcgtt ccggtgtaat atctacaatg aattcatcac ttgaattatg ggcaaatcca      1020
     cttattgatt ctgctactgc atcttctgac ttcaatatac aagaatttaa aaaagttaaa      1080
     acaacagtgt atgtaggatt aacacctgat aatatacagc gtttgcaaaa attaatgcag      1140
     gtattttatc agcaggctac agaattttta agccgtaaaa tgcctgattt aaaggaggaa      1200
     ccatatggag taatgttctt acttgatgag ttcccgactc ttggaaagat ggatactttt      1260
     aaagctggta tcgcttattt tagaggttat agagttcggt tatttttgat tatccaagat      1320
     acgcagcaat taaaaggaac atatgaggac gccggtatga attctttctt atctaattcc      1380
     acatatcgca ttacctttgc tgctaataac tatgaaactg caaatttaat atcgcagctt      1440
     gttggtaata agactgtaga acaaaggtca tttagtaaac ctttattttt tgaccttaat      1500
     atttctacta gaacccaaaa tgtatctcaa gttcaaagag ctttactttt acctcaagaa      1560
     gtaatacagt taccgcgaga tgagcaaatt gttttaattg aatccttccc gcctataaaa      1620
     tctcgtaaaa ttaagtatta cgaagataag ttttttacta gtagattatt accgccgact      1680
     tttgtaccta ctcaagtacc ctttaatcat gtgtcaaata atagtgatgc ttctaaagag      1740
     actgaaacaa caactgctat cgaaaataat gagtaa                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page