(data stored in SCRATCH3701 zone)

EMBL: AE017197.WZM

AE017197.WZM         Location/Qualifiers
FT   CDS_pept        2067..2843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzm"
FT                   /locus_tag="RT0004"
FT                   /product="O-antigen export system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03494"
FT                   /db_xref="GOA:Q68XZ8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ8"
FT                   /protein_id="AAU03494.1"
FT                   /translation="MIKYFFSKKYWRAIALLVKASIIRQNKDSFLGSLWSLIQPFIHIM
FT                   VISYFFGFLLRQPREFMVMNLVGGIPLWSFIVSSLTICASSLVTRDQIIKKVRISKTFF
FT                   PIADSLGQLYTLICSFSAMYFAFILLFPEKFSWQIIFVPILILPLVICVISGSIAVAFL
FT                   TPYIRDIPQILNVILGVIYWSVPIVYPYSLIPESKKVYFEFNPFFLVIRPVQVLVINGT
FT                   LPDMMLIIKSVIVAFITVFISYLIYRQFSKRVIYYL"
     atgataaagt attttttttc taaaaaatac tggcgggcaa tagcattatt agttaaagct        60
     tctataatta ggcaaaataa agattctttt ttaggttctt tatggagttt aattcaacct       120
     tttattcata taatggtcat ttcatatttt tttggttttt tattaagaca accaagagaa       180
     tttatggtaa tgaacttagt aggaggaatt cctttatgga gttttatagt aagtagttta       240
     acgatttgtg caagttcttt agttacacgt gatcaaataa taaaaaaagt tagaatttct       300
     aagacttttt ttcctattgc ggatagttta gggcaattat atactttaat ttgctcattt       360
     tcggcaatgt attttgcttt tattttatta tttccagaaa aattctcttg gcaaataata       420
     tttgtgccta tattaatttt gccattagta atatgcgtga ttagtggttc tattgcagta       480
     gcatttttaa caccgtatat tcgagatata ccgcaaatat tgaatgttat ccttggagtt       540
     atttattgga gtgtaccaat agtatatcca tattcgctaa ttccggaatc taaaaaggta       600
     tattttgaat ttaatccatt ctttttagtt ataagacctg tacaagtatt ggtaattaat       660
     ggaacgttac cagatatgat gttaataatt aagtctgtta tagtcgcatt tattactgtt       720
     tttatcagtt atttaattta tagacaattt tctaaaagag ttatttatta tttatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page