(data stored in SCRATCH3701 zone)

EMBL: AE017197.WZT

AE017197.WZT         Location/Qualifiers
FT   CDS_pept        1312..2070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzt"
FT                   /locus_tag="RT0003"
FT                   /product="O-antigen export system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03493"
FT                   /db_xref="GOA:Q68XZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ9"
FT                   /protein_id="AAU03493.1"
FT                   /translation="MLLNHSKVFIEITDGYVEGIDVHKRAQGLKHFFLKKGVSISPTIP
FT                   ILNNINFSCYEGEKIAFIGSNGSGKSSLLKLIAGIYPLKSGIVKVHGNIAAIIDMGVGF
FT                   EPEQTGRENIKMLMLYNNMLDKYSKKIEKEIIDFSELGSKIDLPIKIYSSGMLSRLAFS
FT                   VSVFQNPQILLLDEIFAAGDSYFIEKSLNLMKNKFKNTPISIIVSHQEEIIKDNCDRCI
FT                   LLKDGNIIGDGTPLEMFKIYKQQSNKEIHK"
     atgttactta accattcaaa agtatttata gagataacag atggttatgt agaaggcata        60
     gatgttcata aaagagccca gggtttaaag catttttttt tgaaaaaagg agtttctatt       120
     tctccaacaa tacctatatt aaacaatatt aatttttctt gttatgaggg agaaaaaata       180
     gcttttatcg ggagtaatgg ttcaggtaaa agttcacttc taaaactaat tgctgggata       240
     tatccgttaa aatcaggtat agtaaaagtt catggaaata ttgctgcaat tatagatatg       300
     ggagttggtt ttgaaccaga acagacaggt cgtgaaaata taaaaatgct aatgctatat       360
     aataatatgt tagataaata tagcaaaaaa attgaaaaag aaattataga tttttcagaa       420
     cttgggagta aaattgattt accgataaaa atttatagtt ccggtatgtt atcacgcctt       480
     gctttttctg tatcggtatt tcagaatcca caaattctat tacttgatga aatttttgca       540
     gcaggtgata gctattttat agaaaaatcc cttaatttaa tgaagaataa atttaaaaat       600
     actcctattt caataatagt aagccatcaa gaagaaatta taaaagataa ttgtgataga       660
     tgtattttat taaaagacgg taatattata ggtgatggaa caccattaga aatgtttaaa       720
     atctataaac aacaaagcaa taaggaaatt cataaatga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page