(data stored in SCRATCH3701 zone)

EMBL: AE017197.ZNUB

AE017197.ZNUB        Location/Qualifiers
FT   CDS_pept        complement(798925..799686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="RT0612"
FT                   /product="zinc/manganese ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04076"
FT                   /db_xref="GOA:Q68WB6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB6"
FT                   /protein_id="AAU04076.1"
FT                   /translation="MTLIILALILISCIFAPLGCIALWKRYIYFGDGLAHSSFLAASIS
FT                   IIAHFPLIYSGIIVAILFSFFVFFFKNNSEKNAVINLISSFMLAVALIINYFTSLQNNI
FT                   VHLLFGDILSVSFNDLIILVVVFITIISFIVYFYNQILLTIINRDIAVIQGLNVNIIEL
FT                   IFLLLLSLSVFAAIKIVGVLMVTAILLIPAMIARFVAYSPSQMIIISIFISLFINFCAA
FT                   FSSFYFDLPLTPLFIVLGTLIYSLFYLKRFL"
     atgactttaa taatactagc cttaatttta attagctgta tatttgctcc attaggctgt        60
     atagcactat ggaagcgata tatttatttt ggtgatgggc tcgctcatag tagtttttta       120
     gcggctagca taagcattat agcacatttt ccattaatat attcaggaat aatagttgca       180
     attctttttt ccttttttgt gttttttttt aaaaataatt ctgaaaaaaa tgcagttatt       240
     aatttaattt ctagctttat gctcgctgtt gctttaatta ttaattattt tacttcttta       300
     cagaataata tagtgcattt gttatttggt gatattttat ccgtatcttt taatgatttg       360
     attatactcg tggtagtgtt tataactata ataagcttta tagtctattt ttataatcaa       420
     attcttctta caattatcaa tagggatatt gcagttatac aaggcttaaa tgtcaatatt       480
     attgagctaa tatttttact gcttctctca ttatctgtat tcgccgctat aaagattgtt       540
     ggagtactta tggttactgc tattttactt attcctgcga tgattgccag gtttgtagca       600
     tatagtccgt ctcagatgat tataatatca atttttatct ctttatttat taatttttgt       660
     gctgcattta gctctttcta ctttgattta ccgttaacgc cattgtttat tgtattaggt       720
     acattgattt atagtttgtt ttatttaaag cggttcttat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page