(data stored in ACNUC10821 zone)

EMBL: AE017262.ADA

AE017262.ADA         Location/Qualifiers
FT   CDS_pept        90096..91148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="LMOf2365_0093"
FT                   /product="Ada regulatory protein"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by similarity to SP:P06134; match to
FT                   protein family HMM PF00165; match to protein family HMM
FT                   PF01035; match to protein family HMM PF02805; match to
FT                   protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02881"
FT                   /protein_id="AAT02881.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESGNGF
FT                   RDAFSKTMGEVPHKSNDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTVIIQQIEAELARYFNGELIDFKTPICYIGSDFQQSVWNELRRIPI
FT                   GETISYKSLAEKLGRPTASRAVARANGANQLSLIVPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPR"
     gtgataacga atcagcggga tattgataaa tattatgata tgttagtgga gaaaaattcg        60
     aattatgaag gcgtattttt tgttggagtg aaaacgacgg gaatactttg tcgcccaacg       120
     tgtccggcga agaaaccttt aaaagagaat tgtgagtttt tcagtacagc caaggaggcg       180
     ctacttgcat cttaccggcc ttgcaagcgt tgtgaaccac tctccaatcc gacgaaattg       240
     tcgccagctg tgaagttgct tgttgatgca attgagaaaa atccagagaa aaaatggacg       300
     gataaagatt ttgatgaatt atccattagc gcaaatacag cgcggcgcca gtttaagaag       360
     cagtttggga tgacttttat tgagtatgcg cgttcgcggc gtctcggtct tgcttttaag       420
     catattcggg gtggaaattc gatcattaat gcacaaattg aaagtggtta tgagtctgga       480
     aatgggttcc gagatgcttt ttcaaaaacg atgggggagg ttcctcataa atcaaacgat       540
     atcaccattt tatactccgc ttggcttgag actaaacttg gatcaatgct cgcaatttct       600
     gatgatgata gtctattgct tctggaattt gttgatcgaa aaggcttgga aacagaaatt       660
     aaaaaattac gaatgcgctt aaacgcggct attacacctg aaaaaacagt aataattcaa       720
     caaatagaag ccgaattagc gcgatatttt aatggtgagt tgattgattt taaaacaccg       780
     atttgctata tcgggtcaga ttttcaacag agtgtctgga atgaactgcg acgaattccg       840
     ataggcgaaa caatttcgta caaaagtttg gcagaaaaac tagggcggcc aacagcaagt       900
     cgagctgtgg caagagcaaa tggggctaac caattatccc tcatcgtccc gtgccatcgt       960
     gtaatcaata ctaacggagc attaggaggc tacggtggcg gtcttgcgcg caaagaatgg      1020
     ctaattaaac atgaaaagat ggttccaagg taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page