(data stored in ACNUC10821 zone)

EMBL: AE017262.ARCC

AE017262.ARCC        Location/Qualifiers
FT   CDS_pept        50468..51409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="LMOf2365_0048"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02836"
FT                   /protein_id="AAT02836.1"
FT                   /translation="MNQKIVVALGGNAILSSDASAEAQQSALEKTAEYLVQFIENGDDL
FT                   IISHGNGPQVGNLMLQQHAGASEKNPAMPLDTCVAMTQGSIGYWMQNALDKAFLKHGLD
FT                   KVAVSLITQVVVDKDDPAFKKPTKPIGPFLTKEEAEKEMAETGAIFLEDAGRGYRKVVP
FT                   SPRPLSIKEHQIIKQLVDSGVVTISAGGGGVSVVENGLDLSGVETVIDKDFASEKLAEL
FT                   ISADLLVILTGVENVYINYNQPNQKKLERVTVSELEKYIDEKQFAAGSMLPKIEAATAF
FT                   VKERPNAKAIITSLENIGAMLEHGAGTVIIAG"
     atgaatcaaa aaatagtcgt ggcactaggt ggaaatgcaa ttttatcgag tgatgccagt        60
     gctgaagcgc aacaaagtgc acttgaaaaa acagccgaat atttggtgca atttatcgaa       120
     aacggggatg atttaattat ttcgcatgga aatggaccgc aagtaggcaa cctgatgctg       180
     caacaacatg cgggagcttc tgaaaagaat ccagcaatgc cgcttgatac gtgtgtcgca       240
     atgacgcaag ggagtattgg ctactggatg caaaatgcgt tagataaagc atttttaaaa       300
     cacgggctag ataaagtagc ggtttcatta attacacaag ttgttgtgga taaagatgat       360
     cctgctttta aaaaaccaac caaaccaatt gggccttttc ttactaaaga agaggctgaa       420
     aaggaaatgg cagaaactgg tgcaatattt cttgaggacg ctggtcgagg ttaccgtaaa       480
     gttgtaccat ctcctcgccc gcttagtatt aaagaacatc aaattattaa acaattggtt       540
     gatagtggtg ttgtgactat ttctgctggt ggaggcggag tttcggtcgt tgaaaatggc       600
     cttgatttat ctggggtaga gaccgtaatc gataaagatt ttgcttctga aaaacttgca       660
     gaactaatta gtgcggattt gttggttatt ttaacagggg tggaaaatgt ttatatcaat       720
     tataatcagc caaatcaaaa gaaacttgaa agagttaccg tttcagaatt agaaaaatat       780
     attgatgaga aacaatttgc agcaggaagt atgttgccca aaatcgaagc agcaacagct       840
     tttgtcaaag aaagaccaaa tgccaaagca ataatcacct cgcttgaaaa tattggcgcc       900
     atgctagaac atggggcagg gacagtgatt attgcgggct ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page