(data stored in ACNUC10821 zone)

EMBL: AE017262.AROD

AE017262.AROD        Location/Qualifiers
FT   CDS_pept        536571..537329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="LMOf2365_0521"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by similarity to SP:P05194; match to
FT                   protein family HMM PF01487; match to protein family HMM
FT                   TIGR01093"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03303"
FT                   /db_xref="GOA:Q723F8"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F8"
FT                   /protein_id="AAT03303.1"
FT                   /translation="MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVV
FT                   EWRVDFFEDVKDLAKVEAALDEIRTILPETPILFTFRSAKEGGELAVGDEFYFELNETL
FT                   ASTGKIDLVDVELFNEETDVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEA
FT                   LGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAM
FT                   TFGAAKKASAPGQIDVNELRHVLDLLHKQF"
     atgaataaag tagtcgtaaa gaatgttacg tttggtgaag gtgcgccaaa aatttgtgta        60
     ccaatggtcg gtaaaacggt tgctgcgctt aaagaagaag cagaaatgtt acaaacaatc       120
     gatttggacg ttgtcgaatg gcgcgttgac ttttttgaag acgtcaaaga tttagctaaa       180
     gtggaagctg cgctagatga aattcgcaca attttaccag aaacaccgat tttattcact       240
     ttccgcagtg caaaagaggg cggcgagtta gctgtcggtg acgaatttta ttttgaatta       300
     aatgaaacac tagctagcac tggcaaaatt gatttagttg acgtggaact tttcaatgaa       360
     gaaacggatg ttttacgttt aatcgaaaca gcccacaaaa acaatgtaaa agtagttatg       420
     tcgaatcatg attttgataa aacacctgcg aaggaagaaa tcgtttctcg cttaactcgc       480
     atggaagcac ttggcgcgga ccttccgaaa atcgccgtca tgccaaaatc tgctggagac       540
     gtactaactt tactagatgc aacgaatact gtatctgaaa aagctaatca accaatcatt       600
     acgatgtcga tggcgggaac tggtgtcatc agccgtcttg ctggcgaagt atttggctcc       660
     gcaatgacat ttggcgctgc gaaaaaagca tcggctcctg ggcaaattga tgttaatgag       720
     ttacgtcacg ttcttgattt actgcacaaa caattttaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page