(data stored in ACNUC10821 zone)

EMBL: AE017262.AROE-1

AE017262.AROE-1      Location/Qualifiers
FT   CDS_pept        535630..536505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE-1"
FT                   /locus_tag="LMOf2365_0520"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by similarity to SP:P54374; match to
FT                   protein family HMM PF01488; match to protein family HMM
FT                   TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03302"
FT                   /db_xref="GOA:Q723F9"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F9"
FT                   /protein_id="AAT03302.1"
FT                   /translation="MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVY
FT                   LAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDD
FT                   GVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRK
FT                   DDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETL
FT                   LPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEM
FT                   PVDYIKEILF"
     atgacaaaca aaatcacaga aagaattaca ggacacacag aattaatcgg tttaatcgcc        60
     actccaatca gacacagttt atcaccaaca atgcataatg aagcttttgc aaaactcggg       120
     cttgattatg tataccttgc ttttgaagtt ggagacaaag aactgaaaga tgttgtacaa       180
     ggattccgcg caatgaactt acgcggctgg aacgtttcca tgccaaataa aacaaatatc       240
     cataaatatt tagataaact ttctccagca gctgaacttg taggggcagt aaatacagtt       300
     gttaatgatg acggcgtgtt aactggacac attacagacg gcactggtta tatgcgtgca       360
     ttaaaagaag ctggacatga tattatcggc aaaaaaatga cgatttgcgg cgctggtggt       420
     gcggcaacag ctatttgtat ccaagctgct cttgacggcg taaaagaaat ttctattttc       480
     aacagaaaag acgattttta cgcgaatgca gaaaaaacag tagaaaaaat caattcgaaa       540
     acagattgta aagcacaatt atttgatatc gaagaccacg aacaattacg taaagaaatc       600
     gcagaaagtg ttattttcac gaacgcgact ggcgttggga tgaaaccttt cgaaggcgaa       660
     acgcttttac caagtgccga tatgcttcgt ccagaattaa tcgtttcgga tgttgtctac       720
     aaaccaacta aaactagatt gcttgaaatc gctgaagaac aaggctgtca aacacttaac       780
     ggcttaggca tgatgctttg gcaaggtgcg aaagctttcg aaatttggac acacaaagaa       840
     atgccagttg attacattaa agaaatccta ttttaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page