(data stored in ACNUC10821 zone)

EMBL: AE017262.CHEA

AE017262.CHEA        Location/Qualifiers
FT   CDS_pept        740905..742761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="LMOf2365_0728"
FT                   /product="chemotaxis protein CheA"
FT                   /note="identified by similarity to SP:P29072; match to
FT                   protein family HMM PF01584; match to protein family HMM
FT                   PF01627; match to protein family HMM PF02518; match to
FT                   protein family HMM PF02895; match to protein family HMM
FT                   PF07194"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03509"
FT                   /protein_id="AAT03509.1"
FT                   /translation="MTTNMLDLFIEEASEHLQALNDNLLQLEKDPTNGQLVSEIFRSAH
FT                   TFKGMSATMGFQQVADLTHAMENVLDEVRNNRLAVTEHLVDIIFTCTSHLETMVSDIQH
FT                   GGQGAADISKTVADLEALLHPEQETDLAVEKTYRIQIQIEEAAILKAVRAVMCLERLAE
FT                   MGIISETTPDREAIELEEFEQSFEVVLESAQTKEEIEAVVLDISEIEKVTVTEEVEEVQ
FT                   VIEPIKKAAKQTTKRLENKTIRVQLEKIEKLMNVFEESVIERARIDEIAEKTNNKELME
FT                   HLGRFSSISKEIQNGLLNMRMVPVDSVFNRFPKMVRTLAKELGKKIDLVIEGADTEVDK
FT                   IVIDEIGDPLVHLIRNSVDHGAETVEVRRKNGKNETATINLKAFHSGNNVVIEIADDGA
FT                   GINKRKVLEKAIAKNVVTRAESTKMTDAEIFDLLFDSGFSTADQVSDLSGRGVGLDVVR
FT                   NTILKIGGKISVESSENAGSTFRIEIPLTLSIIQSMLVATSERRYAVPLANVAEAITIN
FT                   PADIQHVHGKDLINYRETIIEVLDLGECFHETPLNDTDELLLLVVKNAKRTFGLIIKDI
FT                   IGQREIVLKTLGGFFSESQIAFSGATILGDGRVVLILNLETF"
     atgactacaa atatgttaga cctgtttata gaagaagctt cagaacattt acaggcgcta        60
     aatgataatc tgttacagct tgagaaagac ccgacgaacg gtcagttagt aagtgaaatt       120
     ttccgttcag cacatacatt taaagggatg tccgcaacga tgggcttcca acaggtggct       180
     gatttaacgc atgcaatgga aaatgtacta gatgaggtac gcaataatcg attggctgta       240
     acagaacatt tggtagacat tatttttaca tgtacatctc atttggaaac aatggtttcg       300
     gatatccagc acggcggaca aggcgcggcg gatatttcga aaaccgtagc tgacttagag       360
     gcgcttttac atccagaaca agaaacagat ttagcggtag aaaaaacgta tcgcattcag       420
     attcaaattg aagaagcagc tattttgaaa gcagtacggg cggtaatgtg tttagagcga       480
     cttgcagaaa tggggattat ttcagaaaca acgccagaca gagaagcgat tgagctagaa       540
     gagtttgagc agtcattcga agtagtccta gagtcggcgc aaacaaaaga agaaatcgaa       600
     gcggttgttc tagatatttc tgaaatcgaa aaagtgactg tgacagaaga agtggaagaa       660
     gttcaggtta ttgaaccaat caaaaaagcc gcaaaacaaa caaccaaacg attagaaaat       720
     aaaaccattc gtgtacaact tgaaaaaatc gaaaagctaa tgaacgtttt tgaagaaagc       780
     gtcattgaac gggcgagaat tgatgaaatc gcagaaaaaa cgaataacaa agaattgatg       840
     gaacacttag gacgattcag ttccatctcc aaagaaattc aaaacggctt actaaatatg       900
     cgtatggtgc cagtggatag tgtgttcaat cgctttccaa aaatggtgcg cacactagcc       960
     aaagaattag gtaagaaaat cgacttagtg attgaaggcg cggatacgga agtcgacaaa      1020
     atcgtcattg atgaaattgg cgacccactt gttcacttaa tccgtaattc agtagaccac      1080
     ggtgcggaaa cagtcgaagt aagacgtaaa aatgggaaaa atgaaaccgc cacaattaat      1140
     ctaaaagctt tccatagtgg gaacaatgtc gtgattgaaa ttgcggatga cggtgcggga      1200
     atcaataaac gcaaagtgtt agaaaaagcg attgcgaaaa atgtcgttac aagagcagaa      1260
     tcaaccaaaa tgacggacgc ggaaattttt gatttattat ttgattccgg tttcagtacc      1320
     gcggatcaag tatccgatct ttctggccga ggcgtgggac tagatgttgt ccgtaatacg      1380
     attctcaaaa tcggcggaaa aatcagcgta gaatcaagtg aaaacgctgg ttcgacgttc      1440
     cgaattgaga ttccgctgac attatcgatc atccaatcga tgctcgttgc aacatcagaa      1500
     cgtcgctatg ctgtaccgct ggcaaacgtg gccgaagcca tcacaattaa tcctgcagac      1560
     attcaacacg ttcacggcaa agacttaatc aactaccgtg aaaccattat cgaagtactc      1620
     gatttaggcg aatgcttcca tgaaacacct ttgaatgaca cggatgaatt actattactc      1680
     gtcgtgaaaa atgccaagcg aacttttgga cttattatta aagatattat cggtcaacgg      1740
     gaaatcgttt taaaaacact tggtggcttt ttcagcgaaa gtcagattgc cttttctgga      1800
     gcaacgattt taggcgatgg tcgtgtcgta ttaattttaa atttagaaac attttaa         1857
//

If you have problems or comments...

PBIL Back to PBIL home page