(data stored in ACNUC10821 zone)

EMBL: AE017262.CHIB

AE017262.CHIB        Location/Qualifiers
FT   CDS_pept        121757..124039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiB"
FT                   /locus_tag="LMOf2365_0123"
FT                   /product="chitinase B"
FT                   /EC_number="3.2.1.14"
FT                   /note="identified by similarity to GP:2696017; match to
FT                   protein family HMM PF00041; match to protein family HMM
FT                   PF00704; match to protein family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02911"
FT                   /protein_id="AAT02911.1"
FT                   /translation="MNKKMKKLFSITSVVLLVLSLVVVSIGAEPKRAKAAENVPQYRNV
FT                   MYYGDWSIWGGEGNFYPKDIPADQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEGV
FT                   QWGGANAGVLNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKFV
FT                   KYTNMDFVDLDWEYPASVRDADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQGV
FT                   DINKKYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYGN
FT                   PKDPNYDSGFSVDQTVKYLKEKGAVSNKIVVGAAFYTRGWNKVAAGTDTALPGLFQAAE
FT                   KTNKDADGSLTYGANNENPIKTGDGGRAGGVWAYRSIDALKAKTPTLKEYWDDTAKAPY
FT                   LYSKETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKTTTSTKRDELTKAIKSG
FT                   LFGTNAIPQNAITYANLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELSFET
FT                   VKLPKFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKSS
FT                   ASSVDVANISKIDLTQRMVKSSVEFGKQTIFGGGTVVPDPSDTEAPTVPKALTSSNVTD
FT                   KSATLTWTASTDNKAVAGYKVYRNGTEVGSVSGTTFTDSGLTAKTAYSYTVKAYDAAGN
FT                   FSAASSALTVTTLDAATPPATPAWDAAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQW
FT                   GPWLLIN"
     atgaataaga agatgaaaaa gctttttagt attacttctg ttgtgttgtt agttttatcg        60
     ttagtggttg tatcaattgg tgcagagcca aaacgggcga aagcggctga aaatgtacca       120
     cagtatcgga atgttatgta ttacggtgat tggtcgattt ggggaggaga agggaacttt       180
     tatccgaaag atattccagc tgatcaatta acacatttga attttgcttt tctggatttt       240
     aatagtaatg gggatttagt ttttactgat aaagatgctg ctgttggggc gcctgttgga       300
     caagagggag ttcaatgggg cggagcaaat gcaggcgttt tgaatgcgat tcaagatttg       360
     cgcgctcaaa atccgaattt gaaaataggg gtttcagttg gaggctggtc taagtcggga       420
     gatttctcga cagttgcagc ggatccaaca aaacgggcta actttgtgaa aaacgtgatg       480
     aagtttgtga aatatactaa tatggatttt gttgatttgg actgggaata tcctgcttcg       540
     gtacgggacg ctgaccttgt tgataataaa aacgatgaag gcacaccaaa tgcaaaacct       600
     gcggataagc aaaactttat tacactttta caagatttaa gaacggcttt ggataaacaa       660
     ggcgtggata ttaacaagaa atacgaatta tcggttgctt taccagctgc aaaatctact       720
     ttagaaaatg ggattgatgt agcgaattta tttaaagtag tcgattttgc gaatgtgatg       780
     acgtatgact taaatggtgc ttggacaccg aatagtgcgc atcatacagc gctttacggc       840
     aatccgaaag atccgaatta tgatagtggt ttttctgtcg accaaaccgt taaatactta       900
     aaagaaaagg gagcagtttc gaataaaatt gttgttgggg cagcatttta cactcgaggc       960
     tggaataaag tagctgctgg aacggatacg gcattgccag ggcttttcca agctgctgaa      1020
     aaaacgaata aagatgcgga tggctcgctt acttacgggg caaacaacga aaacccaatt      1080
     aaaacaggcg atgggggccg tgctggcgga gtttgggcgt atagaagtat tgatgcgcta      1140
     aaagctaaaa cgccaacatt gaaagaatat tgggatgata ctgccaaggc gccgtatctt      1200
     tatagtaagg agactgggga gttttacaca tatgacaata cgcgttcaat tggctataag      1260
     gcacagtatg taaaagataa taatcttggt gggatgattt cttggatgca gtcgcaggat      1320
     aaaacaacga cttcaactaa gcgcgatgaa ctcacaaagg cgattaaatc aggattattc      1380
     ggcacaaacg ctatcccgca aaacgcgatt acttatgcga atttaaatgt ggtagcgaca      1440
     gtgaaacctt atagcgaaaa tggggtcggg tacgaaatta caattacaaa caatgaaaaa      1500
     gcggacgaaa ccaatgaagt tttgaaatca actgagctat cgtttgaaac agtgaaatta      1560
     cctaagtttt atattccagt aaaagcgggc gaaacgttaa ctgctggcga ttataaagcg      1620
     ggtacagtta ctacttcagg tggcaataca gtagttgatt tagcttctgt atacgacgcg      1680
     caacaaattc cgcaaggcgc atcttatacg ttccgtttaa aatcgagtgc atctagtgtg      1740
     gatgtagcta acatttctaa aattgattta acacaacgga tggtaaaatc gagtgtcgaa      1800
     tttggtaaac aaacgatttt tggcggggga actgttgtac ctgatccaag cgatacagaa      1860
     gctccaacag taccaaaagc actcacatct tctaatgtaa ccgataaatc tgctactcta      1920
     acgtggacag cttcaacgga caataaagca gtggctggat ataaagtgta ccgaaatggg      1980
     accgaagtgg gctctgtttc aggaactact tttacagata gtggcttaac tgcaaaaaca      2040
     gcgtattctt atacagtaaa agcatatgat gcggctggga atttctcagc agcaagctcg      2100
     gccttaactg tgacaacgct tgatgcggca acaccaccag caactccagc atgggacgct      2160
     gccaaaacgt acaataaggg agatagggtt tcttacaaag ggaaaacata tgaagcacag      2220
     tggtggactc agggaaatga gccaggagct gaacagtggg gtccttggtt gttaataaat      2280
     taa                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page