(data stored in ACNUC10821 zone)

EMBL: AE017262.CLS-1

AE017262.CLS-1       Location/Qualifiers
FT   CDS_pept        10727..12241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls-1"
FT                   /locus_tag="LMOf2365_0008"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by similarity to SP:O66043; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02798"
FT                   /protein_id="AAT02798.1"
FT                   /translation="MRKLIQFLFIAVVLFLVEYFLINQAAILFLVTSGLIQLCGLIIVI
FT                   RLLLFDQRNTSSKVAWIAVIFILPVLGTISYLVFGRNPATRKFSTAQVMEKAKLINAIH
FT                   AIPNNTNEKLPRLSKRIAHLTSIEPIKGNKIEILTNGEETFPVLLDALRKAENHIHIQY
FT                   YIFKTDEISTKIRDILVEKAKAGVEVRFMFDGLGSSKLGKAFLAPLKEAGVSIHAFDPI
FT                   TSPWIVRTANLRNHRKIVVIDGQIGFTGGLNIGEEYRSNTPDFRVWRDTHIKITGQAVI
FT                   ELQESFLNDWVYMENQAGAADQFISEAGLQQYFSPVDVGDEWAQVIYGGPYDKEKWVRD
FT                   SMLDLIDSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNA
FT                   YVKTMIEAGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDES
FT                   EAMHHLKRDFEKDFEDSRLFTMKDMENKPLLTRIKEVLSSLLSPIL"
     atgcgcaaac tgattcaatt tctgtttata gcagtagttt tatttttagt ggaatacttt        60
     ttaatcaatc aagcagctat attattctta gtaacaagtg gacttatcca attatgcgga       120
     ttaattattg tgattcggct actactcttt gatcaacgga atactagctc aaaagtcgcc       180
     tggattgcgg ttattttcat tttacctgta cttggaacga ttagttacct tgtgtttggt       240
     agaaatccag caactagaaa attcagcaca gctcaagtaa tggaaaaagc taaattaatt       300
     aatgcgattc acgcaattcc aaacaacact aatgaaaaat taccacgact atctaaaaga       360
     attgcgcatt taacgtccat agagccaatt aaggggaata aaatcgaaat attaacaaat       420
     ggcgaagaaa cttttccagt gctcttagac gcgcttagaa aggctgaaaa ccacattcat       480
     attcaatact atattttcaa aacggatgaa atttctacaa agattcgtga tattttggta       540
     gaaaaagcaa aagcaggcgt tgaagttaga tttatgtttg atgggcttgg atcaagcaaa       600
     ctgggtaaag cctttttagc tcctttgaaa gaagctggag ttagtattca cgcatttgac       660
     ccaattacct ctccctggat tgtaagaaca gccaatttaa gaaatcaccg taaaattgtc       720
     gtgattgatg gtcaaattgg ctttacaggc gggcttaata ttggagaaga atatcgttct       780
     aatacaccag atttccgtgt ttggcgcgat acacatatta aaatcacagg ccaagctgtt       840
     atcgaacttc aagaatcttt tctaaatgat tgggtctata tggaaaacca agcaggtgct       900
     gcagatcaat ttattagtga agctggatta caacaatatt tttcaccagt tgatgtgggt       960
     gacgaatggg cgcaagtgat ttacggcgga ccatatgata aagaaaaatg ggttcgcgat      1020
     tcgatgcttg atttaattga ttccgctaaa gaatctgttt ggattgtgtc gccttacttt      1080
     gttccagatg aggagtcgct tgcagttatt cgccgggttg cgatgagcgg tgttgacgtg      1140
     cgagttatta ttccaggcaa aggtgatcgc gggatttcat tccacggaag taatgcgtat      1200
     gtgaaaacaa tgattgaagc aggcgcgaaa atgtatgctt atgccgatga ttcttttgtt      1260
     catgcgaagg caatgctagt ggacgggacg cgtgcagcta taggtactgc caattttgac      1320
     gtgcgtagtt ttagattgaa tcatgaatta atggtattct tatatgatga aagcgaggct      1380
     atgcatcatt taaaacgtga ttttgagaaa gattttgaag atagccgact ttttacgatg      1440
     aaagatatgg aaaacaaacc attattgact cgtataaaag aagttctatc tagtttacta      1500
     tcaccaattt tataa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page