(data stored in ACNUC10821 zone)

EMBL: AE017262.CYSE

AE017262.CYSE        Location/Qualifiers
FT   CDS_pept        264118..264732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="LMOf2365_0250"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by similarity to SP:Q06750; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03037"
FT                   /protein_id="AAT03037.1"
FT                   /translation="MPTRLKEDIATIIKNDPATKSFFDAFLTNPGLHALWWHRVANFFY
FT                   RHKMVLFGKVLSQNARFWTNIEIHPGATIGRRLFIDHGAGIVIGETAEIGDDVTIFHGV
FT                   TLGGTGKDCGKRHPTVGDGALVSAGAKVLGPVEIGAGARIGAGAVVLKDVPPGATVVGI
FT                   PAKVVRLNGRTVGHAVPKMDELTLRIAELENIVEKLLKEKE"
     atgccaactc gcttaaaaga agatattgca acaattataa agaatgaccc tgcgacgaaa        60
     agcttttttg atgctttttt aacgaatccg ggattgcacg cactttggtg gcatcgtgtg       120
     gcgaactttt tttatcgtca taaaatggtt ttgtttggaa aagtattatc gcagaacgct       180
     cgtttctgga ctaatataga gattcatcca ggcgcaacta ttggtagaag gctttttatt       240
     gatcatggtg caggaattgt tattggtgaa acagcagaaa ttggggatga tgtaacgata       300
     ttccacggag ttacgctagg tggaactgga aaagattgcg ggaaacgcca tccaactgtc       360
     ggtgacgggg cgcttgtttc ggcaggagcg aaagtacttg ggccggtgga aattggagca       420
     ggagcgcgta ttggagcagg agctgtcgtt ttaaaagatg tacctccagg cgcgacggtt       480
     gttgggattc ctgctaaggt tgttcgtttg aatggtcgta cggtaggaca tgcggttcct       540
     aaaatggatg aactgacatt acgaattgcg gaattagaaa atatagtaga aaaacttttg       600
     aaggaaaagg agtag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page