(data stored in ACNUC10821 zone)

EMBL: AE017262.CYSS

AE017262.CYSS        Location/Qualifiers
FT   CDS_pept        264739..266154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="LMOf2365_0251"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03038"
FT                   /db_xref="GOA:Q724H3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H3"
FT                   /protein_id="AAT03038.1"
FT                   /translation="MSIQIFNTLKREKEPFKPLKDGEVKMYVCGPTVYNYIHIGNARPI
FT                   IVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQL
FT                   NVAKATVNPRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSEL
FT                   QHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTID
FT                   IHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVL
FT                   KDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEE
FT                   AHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLAKETVSINVLREFL
FT                   SMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII
FT                   LEDTAQGTRFRRG"
     ttgtcgatac aaatttttaa tacgttaaaa cgagagaaag agccttttaa accactcaaa        60
     gatggcgaag tgaaaatgta cgtttgcgga ccgactgtgt ataactacat tcatatcggg       120
     aatgcgcggc caattattgt tttcgataca gttcgacgtt attttacgta tcgtggttat       180
     gatgtgaaat tcgtgtctaa ttttacggat gtggatgata aattaattcg tgcggcaaat       240
     gagctaaagt tgacggttcc cgaagtggcg gatcgtttta ttggggctta ctttgatgat       300
     gtagatcaac tgaatgtggc gaaagcgact gtgaatccac gtgtaacgga gaatatggat       360
     gaaattattc aattgatcag tacgctaatt gaaaaaggct atgcgtatga gtcggctggt       420
     gatgtgtatt tccggacgaa aaaattcaaa gattacggga aactatctgg ccaagaatta       480
     tcggaattgc agcacggggc tcgggttgaa tataatgagc gtaagcaaga tgaacttgat       540
     ttcacccttt ggaaagcggc taaaccgggt gaaattttct gggaaagtcc gtttggtaat       600
     gggcgcccgg gttggcatat tgaatgctcg gcgcttgcga aaaaatatct tggtgacacg       660
     attgatattc atgcgggtgg gcaagattta gtattccctc accatgagga tgagattgct       720
     caatccgaag cggcaactgg gaaaacgttc gcgaactact ggatgcataa tgccttttta       780
     aatattgatg gggaaaaaat gtccaaatca cttgggaatt ttattacgct gcatgatgtg       840
     ctaaaagaca atgatccaaa tgtgattcgt ttcttcatgc tatctgtaca ttaccggaag       900
     ccaattacac tgaatgatgc aattttagaa gatgcgaaaa atgggttgga acggttaatg       960
     attgcatacc aaaatattga tcaccgtatt caaacggatg acggtgaata tgtggaagaa      1020
     gcgcatgagg atgaatggct agaacaacta acggaattaa aacaagcttt tgaagatgat      1080
     atggatgatg atttcaatac agcaaatgcg attactactt ttcacgaact tgcaaagcgt      1140
     gccaatattt atttggctaa agaaactgtt tctatcaatg ttctgcgcga attcttaagc      1200
     atgatgcgtt tgtttgcgga agtattaggc ttgaaattag aaaatacgca aactgattcg      1260
     ctggatgata gcgaagtaga agcgttaatt gaagaacgtc tgcaagcgcg aaacgaacgt      1320
     aattttgcac gcgctgatga aattcgagac attttaaaag aaaaaaatat tattttggaa      1380
     gacactgcgc aaggcacgcg gtttagacgg gggtaa                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page