(data stored in ACNUC10821 zone)

EMBL: AE017262.DNAA

AE017262.DNAA        Location/Qualifiers
FT   CDS_pept        319..1674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LMOf2365_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P05648; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF00308; match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02791"
FT                   /db_xref="GOA:Q725H0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725H0"
FT                   /protein_id="AAT02791.1"
FT                   /translation="MQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISA
FT                   PNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPNPALDEDGIE
FT                   IGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAV
FT                   GHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKE
FT                   GTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRI
FT                   AILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEA
FT                   LKDIIPSSKSQVITISGIQEAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDA
FT                   SLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF"
     gtgcaatcaa ttgaagacat ctggcaggaa acactgcaaa tcgttaaaaa aaatatgagt        60
     aaacctagtt acgacacatg gatgaaatca acaaccgctc attcacttga aggtaacacg       120
     tttattattt cagcgcccaa taattttgtt cgcgattggt tagagaagag ttacacgcaa       180
     tttatcgcta acattttgca agaaataact ggtcgcttat ttgatgtccg ctttattgat       240
     ggcgagcagg aagaaaactt tgaatacact gtgattaaac caaatccagc gttagatgaa       300
     gatggcattg aaattggaaa acatatgctt aatccgcgtt atgtttttga tacttttgtc       360
     attggttcag ggaacagatt tgcccacgca gcatcacttg cagtagccga agcaccagcg       420
     aaagcatata atccactctt catttatgga ggagttggcc tcggtaaaac acatttaatg       480
     cacgcagttg gccactatgt tcaacaacat aaagataatg cgaaagtaat gtacctttcc       540
     agcgaaaaat tcaccaatga gtttattagc tctattcgtg ataataaaac cgaagaattc       600
     cgtacaaaat accggaatgt ggatgtctta cttattgatg atattcaatt tttagcaggt       660
     aaagaaggaa cacaagagga atttttccat acatttaaca cactttatga tgaacaaaag       720
     caaattatta tttccagtga ccgaccaccg aaagaaattc caacattgga agatcgactg       780
     agatcccgct ttgaatgggg cctaattact gatattacgc caccagactt agaaacacgg       840
     atcgccattt tacgtaaaaa agcaaaagca gacggattag atattccaaa tgaagtcatg       900
     ctttacatcg caaaccaaat tgattcgaat attcgcgagc tagaaggcgc actcatccga       960
     gtagttgctt attcttccct cgttaataaa gatataacag ctggtcttgc agcagaagca      1020
     ctaaaagata ttatcccctc ttctaaatca caagttatta caattagtgg tattcaagaa      1080
     gcagtcggtg aatatttcca tgttcgttta gaagatttta aagcaaaaaa acggacgaaa      1140
     agtatcgcat tcccgcgcca aatcgctatg tatctttcaa gagagcttac agatgcctca      1200
     ttaccaaaaa tcggtgatga atttggtggt cgagatcata caaccgtcat ccatgcacat      1260
     gaaaaaatat cgcaactact aaaaaccgat caagtgttga aaaatgacct tgccgaaatt      1320
     gaaaaaaatt taagaaaagc acaaaatatg ttttaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page