(data stored in ACNUC10821 zone)

EMBL: AE017262.FLID

AE017262.FLID        Location/Qualifiers
FT   CDS_pept        755129..756391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="LMOf2365_0743"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="identified by similarity to GP:145988; match to
FT                   protein family HMM PF02465; match to protein family HMM
FT                   PF07195"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03524"
FT                   /protein_id="AAT03524.1"
FT                   /translation="MDPTQYYSQFISLQKASLEKAKTPYQNQISSYQSRIDLYASLKNA
FT                   LSESLKTMSSFTTYESKTKLATSSNETSFTVSSTSSSVNGSYSIEVQNLATADTYNKAV
FT                   PDIEAKIGVSGTIKINGKEIKVDADSSMKNVMNSINSAGAKVNIYTLGENMVVTSSTTG
FT                   VENSIKFEGDSAVLDALGLVQNSPDHLAAEDAKLRINGATVTSATNKVTNYIPGVTINL
FT                   KKETTGAEKLTIQDQSDEKAASMITSFVNTYNALTSTMKTYTGKGTILQASAADLEANR
FT                   ALNNVFQHKKDGNTLFDFGISVDKEGVLKVDETAMKKMVAEDPTAVERFFFGIGGIGDE
FT                   LYQSLNKTFGSTGFISDETTSMTNEINKLNLKLTDITSRNDTLLTNITDQYNKWLEMMQ
FT                   AMQSDAMTLDALIDGMNSSNK"
     atggacccaa cgcaatacta ttcgcaattt atcagtcttc aaaaagctag tttggaaaaa        60
     gcgaaaacgc cttatcaaaa ccaaatttcc agctaccaat cacggattga tctttatgct       120
     agtttgaaaa atgctttatc tgagtcgctg aaaacgatga gctctttcac gacttatgaa       180
     agtaaaacca aacttgcgac ttcatccaac gaaacgagtt ttactgtttc atcaacgagc       240
     agttccgtca acggcagtta ttctatcgaa gtccaaaact tggcgactgc agacacatac       300
     aacaaagcag tacctgatat cgaggcgaaa atcggtgtaa gcgggacaat caaaatcaat       360
     ggcaaagaaa ttaaagttga tgcagatagc tcaatgaaaa atgtgatgaa ctccatcaat       420
     agcgccggag ctaaggtgaa tatctacacg ctaggcgaaa acatggtcgt aacttcttca       480
     acaaccggtg tcgaaaacag tattaaattt gaaggcgatt cggctgttct cgatgcactt       540
     ggattagtac aaaattcccc agaccattta gctgcagagg acgccaaact cagaatcaac       600
     ggagcgaccg ttacaagtgc aacaaacaag gtaaccaact acatcccagg cgtgaccatc       660
     aacctcaaaa aagaaacaac tggcgctgaa aaattaacca tccaagacca aagcgatgaa       720
     aaagcagcca gcatgatcac cagttttgta aatacataca atgcactaac aagcacaatg       780
     aaaacctaca cgggaaaagg aacgatttta caagcatctg ctgccgacct cgaagcaaat       840
     cgcgccctaa acaacgtatt ccaacataaa aaagatggga atacattatt cgattttgga       900
     ataagtgtcg acaaagaagg cgttttaaaa gtcgatgaaa ctgcaatgaa aaaaatggta       960
     gctgaagacc caaccgccgt cgaaagattt ttctttggca ttggcggaat tggcgatgaa      1020
     ctgtatcaat ctttgaacaa aacatttggc tcgacaggct ttatcagtga tgaaacgacc      1080
     tcgatgacga atgaaatcaa taaattaaac ctcaagttaa ccgatattac tagccgaaat      1140
     gacacgttat taacgaatat tacggatcaa tacaacaaat ggcttgaaat gatgcaagct      1200
     atgcaaagcg acgccatgac gctagacgcc ctcatcgatg gcatgaacag ttctaataaa      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page