(data stored in ACNUC10821 zone)

EMBL: AE017262.FLIG

AE017262.FLIG        Location/Qualifiers
FT   CDS_pept        759929..761035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="LMOf2365_0750"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by similarity to SP:P23448; match to
FT                   protein family HMM PF01706"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03531"
FT                   /protein_id="AAT03531.1"
FT                   /translation="MAETLKETLEETNAELETVEVEETEEKTATSADSGISRREKAALI
FT                   IWSLDEQIATEVVDLLPDASKQRLAREMAKMKEMDGGAVEEATREFLGELELLSGGIAK
FT                   LDREHLQRLFPDMTTEELNQLIYGVEAESRIGETALDILREIDDVDSLFTIISDESPQT
FT                   IAMIASYMKPEEASKLLALLPEEKMINTVIGIASLEQFDSEVMQNVSNLLRIKLDTMSN
FT                   SSLNKTDGIKNVANILNNVTRGLERTIFEHLDAEQAELSERIKEKMFMFEDIILLDNMT
FT                   LQQVLAEIQDNNKIARALKNEKEELKEKILSCVSKNRRDMITEELEVLGPIRLSDVEQA
FT                   QQDIANVVKNLEKDGKIVIQRGEQDVLI"
     atggcagaaa cactcaaaga aaccttagaa gaaacaaatg ctgaactaga aactgtcgaa        60
     gtagaagaaa cggaagaaaa aacagctact tcagcagatt caggtatttc aagacgtgaa       120
     aaagccgcac ttattatttg gagcctcgac gaacaaatcg cgaccgaagt ggtagatttg       180
     ctccctgacg catccaaaca acgccttgca cgtgaaatgg ccaaaatgaa agaaatggac       240
     ggcggcgcag tagaagaagc aactagagaa tttttagggg aattagaact tctttcagga       300
     ggaattgcta aactcgaccg cgaacactta caacgcttgt tcccagacat gacgacggaa       360
     gaactaaatc aactcattta cggggtagaa gcagaatcac gtatcggcga aaccgcgcta       420
     gatattttac gagaaattga tgatgttgac tccttgttta caattattag cgacgaatcg       480
     ccacaaacca tcgcgatgat agcttcatac atgaaaccag aagaagcatc gaaactacta       540
     gccttactac cggaagaaaa aatgattaac accgtcattg gtatcgcgag cctagaacaa       600
     ttcgatagcg aagtcatgca aaacgtttct aacttgctaa gaattaagct cgataccatg       660
     tcgaatagct cactgaacaa aacagatggc ataaaaaatg tcgcaaatat cttaaacaat       720
     gttacccgag gtttagaacg tacaattttc gaacatctcg acgccgaaca agccgaactt       780
     tccgaacgca tcaaagagaa aatgtttatg tttgaagata ttattctact tgataacatg       840
     accttgcaac aagtgttggc agaaattcaa gacaacaata aaatcgctcg agcactcaaa       900
     aacgaaaaag aagagctcaa agaaaaaatt ctatcttgcg tatcgaaaaa ccgtcgcgat       960
     atgattaccg aagaattaga agttcttggc ccaatcagac tttctgacgt cgagcaagcc      1020
     caacaagata tcgccaatgt cgttaaaaat ctggaaaaag atggcaaaat agttatccaa      1080
     cggggggaac aggatgtcct tatctaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page