(data stored in ACNUC10821 zone)

EMBL: AE017262.FLIM

AE017262.FLIM        Location/Qualifiers
FT   CDS_pept        746514..747506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="LMOf2365_0735"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="identified by similarity to SP:Q57511; match to
FT                   protein family HMM PF01052; match to protein family HMM
FT                   PF02154"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0735"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03516"
FT                   /protein_id="AAT03516.1"
FT                   /translation="MSDKLSQEQIDALLSQISEGKVVDESTEIGDFGRFHPYDFHKPEK
FT                   FGAEHLESLKTIASAFTKKSMEFVSQRIRIPIHTEATLADQVSFASGYIETMPNDSYIF
FT                   CIIDLGNPELGQIIIELDLAYIIYIHECLSGGNPKRKLSERRLLSVFEELTLKSILEKF
FT                   CEALKDSFKSVHPISPEIVNIETNPALLRVTSPNDMMALVSVDIKSEFWISTMRIGVPF
FT                   FSVEEIMNKLENVVEYTFDKRRNFDAEVEQELHQVEKEARIRVGEIKTTWKELNKLEVG
FT                   DVLLTETHIRDTLKGYVTEKWKFECYMGKSGNQKAVKFMRHTGRTEQER"
     atgagcgata aattaagtca agaacaaatt gacgccctgc tttcccaaat aagtgaaggt        60
     aaggtagttg atgaaagtac ggaaattggc gactttgggc gctttcatcc ctatgacttt       120
     cataaaccag agaaatttgg cgcagaacac ctcgaaagct taaagacgat tgcatccgct       180
     tttacgaaaa aaagcatgga gtttgtttcc cagcgtatcc ggattccaat tcataccgaa       240
     gcaacccttg cagatcaagt ttcctttgcg agtggttata tcgaaacaat gccgaacgat       300
     agctacattt tctgcattat cgacctgggt aatccggagc tcggtcaaat tattatcgaa       360
     ctcgatttag cctatatcat ttatattcat gaatgcttat ctggcgggaa tccaaaacga       420
     aaattgagcg agcgcagact tttatctgtt tttgaagagc tgacgttgaa atctatttta       480
     gaaaaattct gcgaagcact caaagacagt tttaaatcag tgcatccaat ctcaccagaa       540
     atcgttaata tcgaaactaa cccagcactt ctacgtgtca catcaccgaa cgacatgatg       600
     gcgcttgtca gtgttgatat taaatcagag ttttggatta gtacaatgcg cattggcgtg       660
     ccgtttttct cggtggaaga gattatgaat aagctggaaa acgttgtgga atatacgttt       720
     gataaacggc ggaactttga tgcggaagtc gagcaagaat tgcatcaagt tgagaaagaa       780
     gcgcgcatac gtgtaggtga aattaaaaca acgtggaaag aactgaataa gcttgaagta       840
     ggcgacgtgc ttctgacaga aactcatata cgtgacacac tcaaaggcta cgtcactgaa       900
     aaatggaaat ttgaatgtta tatgggaaaa agtggtaacc aaaaagccgt taaatttatg       960
     cgtcatacag ggcggacaga gcaggagagg tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page