(data stored in ACNUC10821 zone)

EMBL: AE017262.GDHA

AE017262.GDHA        Location/Qualifiers
FT   CDS_pept        complement(605570..606946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="LMOf2365_0589"
FT                   /product="glutamate dehydrogenase, NADP-specific"
FT                   /EC_number="1.4.1.4"
FT                   /note="identified by similarity to SP:P00370; match to
FT                   protein family HMM PF00208; match to protein family HMM
FT                   PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03371"
FT                   /protein_id="AAT03371.1"
FT                   /translation="MAQTSTIQNDTKAAEEYAARVFETIKLRNPGETEFHQAVEEFLNS
FT                   VIPALAKEPKYEANGILEQLTEPERLISFRVPWVDDSGTVHVNRGYRVQFNSAIGPYKG
FT                   GLRFHPSVTGSIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDSEVMRFCQSFMT
FT                   ELQKHIGPDTDVPAGDIGVGGREIGYLFGQYKRLRGAYDAGTITGKGLSYGGSLARTEA
FT                   TGYGLVYFTVEMLEAAGETIRGKKIVVSGSGNVAIYAIEKAHELGAKVVACSDSAGFVY
FT                   DKEGIKVETVKQLKEVERKRISEYTTIHPSAEYYAGGDVWSVPCDIALPCATQNEINAD
FT                   QARALVKNGVIAVAEGANMPSTLDAVDIYHENKVLFGPAKAANAGGVAVSALEMAQNST
FT                   RMSWTFQTVDEHLQNIMKDIYKNSSNAASEYGAPGNLVIGANIAGFLKVADTMISQGII
FT                   "
     atggcacaaa catccactat tcaaaatgac acaaaggcag ccgaagaata cgcagctcgc        60
     gtgtttgaaa caattaaact acggaatcct ggcgaaacgg aattccacca agcagttgaa       120
     gaattcttaa actctgttat cccagccctt gcaaaagaac ctaaatacga agcaaatggt       180
     attttagaac agttaacaga acccgaacgc cttatcagtt tccgagttcc atgggtggat       240
     gattctggca cagtacatgt aaatcgcggt taccgtgtcc aattcaatag cgcaattggt       300
     ccatataaag gcggtcttcg tttccaccct tccgttactg gaagcatcgt caaattcctc       360
     ggttttgaac aaatcttcaa gaactcccta actggcttac caatcggtgg cggtaaaggt       420
     ggctctgact ttgatccaaa aggaaaatca gactcagaag taatgcgttt ctgccaaagt       480
     tttatgactg aactacaaaa acatatcggt ccagatacag atgttcctgc tggtgatatt       540
     ggtgttggtg gtcgtgaaat tggctactta ttcggtcaat acaaacgtct tcgcggtgcg       600
     tatgatgccg gtacaattac aggtaaaggc ctttcttacg gcggaagttt agctcgtaca       660
     gaagcaaccg gttacggtct tgtttatttc accgttgaaa tgttagaagc agccggtgaa       720
     accattcgcg gcaaaaaaat cgtcgtttct ggttcaggta acgttgcgat ttatgcaatc       780
     gaaaaagcac acgaattggg cgctaaagta gttgcatgta gcgattctgc tggttttgtt       840
     tatgacaaag aaggtatcaa agttgaaaca gtaaaacaat taaaagaagt agaacgtaaa       900
     cgtattagcg aatacacaac cattcatcca tctgcagaat attacgcagg cggcgacgta       960
     tggtccgttc catgtgatat cgcactacca tgtgcaactc aaaatgaaat caacgctgac      1020
     caagctcgtg cccttgtaaa aaatggtgtt atcgctgttg cagaaggcgc aaacatgcct      1080
     tctactcttg atgcagtgga tatttaccac gaaaataaag ttctattcgg tcctgcaaaa      1140
     gctgccaatg ctggtggtgt tgccgtatca gcacttgaaa tggcacaaaa cagcacacgt      1200
     atgagctgga ctttccaaac agtcgacgaa catttacaaa acatcatgaa agatatttat      1260
     aaaaattcaa gcaatgctgc aagcgagtat ggcgcacctg gtaacctagt tatcggcgca      1320
     aatatcgccg gattcctcaa agtagcagac acaatgattt ctcaaggtat tatttaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page