(data stored in ACNUC10821 zone)

EMBL: AE017262.GLTX

AE017262.GLTX        Location/Qualifiers
FT   CDS_pept        262244..263719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LMOf2365_0249"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03036"
FT                   /db_xref="GOA:Q724H5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H5"
FT                   /protein_id="AAT03036.1"
FT                   /translation="MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRI
FT                   EDTDAKRNIADGEESQMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDE
FT                   GLAYKCYCTEEELDAEREKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPA
FT                   NETITFNDMVKDDVSFESNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHIS
FT                   NTPKQILIYNAFGWEPPIFGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFN
FT                   FIAMLGWSPEGEEEIFSKEEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVV
FT                   ELSLPHLQKAGVVSAELDQAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFD
FT                   EEETAVLAEETVPTVISAFKKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIV
FT                   TTGEMHGPELPLAIEVLGREKVLNRLDTWLKNN"
     gtgagtgaaa caaaacgagt acgtgtacgt tatgcaccaa gtccaactgg atttttgcat        60
     attgggaatg cgcgtactgc cctatttaac tatttatttg caagacataa tgatggagat       120
     tttatcattc gaattgaaga cacggatgcg aaacgtaaca tagctgacgg tgaagaaagt       180
     cagatgacaa atttgaaatg gctaggtatg gactgggatg aaggtgtgga tgttcctgga       240
     aaatacggac cttaccgtca atcggaacgt caatccattt atgaaccgtt aattcaacaa       300
     cttctggatg aaggtttggc ttataaatgt tattgtacgg aagaagagct ggatgctgaa       360
     cgtgaaaaac aaaaagcaaa cggtgaaatg cctcgttata gcgggaaatg tcgtcattta       420
     acaaaagaac aacaagcgga gaaagaagcg caaggtttta aaccaagtat tcgtttcaaa       480
     gtgccagcaa atgaaacaat cacttttaac gatatggtga aagacgatgt ttcttttgaa       540
     tcaaatggaa taggcgattt tgttattgcg aaaaaagatg gaattccgac ttataacttt       600
     gctgtagcag tggatgacca tttaatggaa atctctcatg ttcttcgtgg ggatgaccat       660
     atttcgaata cgcctaagca aattttgatt tataatgcat ttggctggga gccgccaatt       720
     tttggtcata tgacacttat tgtgaatgag agcagacgta aattaagtaa acgtgacggt       780
     tcgattattc aatttatcga acaatatcgc gatttaggat atttaccaga agcattattt       840
     aactttattg ctatgcttgg ttggtctcca gaaggggaag aagaaatttt ctctaaagaa       900
     gaattcatta aaatgtttga tccgaagcgt ttatctaaat caccagcatt atttgataat       960
     gttaaattga cttgggtgaa taaccaatat gtgaaaaaat taccactaaa cgatgtagta      1020
     gaactatcgc taccgcattt acaaaaagca ggtgttgtat ctgctgagtt agatcaagcg      1080
     gaacttgatt gggtgcacaa attagtgtca ctttatcatg agcaaatgag ctatggtgcg      1140
     gaaattgtgc cactttctga aatgtttttt gctgacgcag agtccattac gtttgatgaa      1200
     gaagaaacag cagtgcttgc ggaagagaca gttccaactg ttatttcagc attcaaaaaa      1260
     gaattagaag cactagaagt tctagaagct gcggaagtaa aagcggcaat caagcgggtt      1320
     caaaaagaaa cgggcgtaaa aggtaaaggt ttatttatgc caattcgtat tgtgacaacg      1380
     ggtgaaatgc atggtcctga attgccactt gcaatcgaag ttcttggtcg tgaaaaagtg      1440
     cttaatcgtt tggatacatg gttgaaaaat aattaa                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page