(data stored in ACNUC10821 zone)

EMBL: AE017262.GTFA

AE017262.GTFA        Location/Qualifiers
FT   CDS_pept        281310..282752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtfA"
FT                   /locus_tag="LMOf2365_0271"
FT                   /product="sucrose phosphorylase"
FT                   /EC_number="2.4.1.7"
FT                   /note="identified by similarity to SP:P10249; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03058"
FT                   /protein_id="AAT03058.1"
FT                   /translation="MQIKNKAMLITYSDSLGKNMEELSKVMETYFEDAVGGIHLLPFFP
FT                   STGDRGFAPSDYTTVDSDLGSWEIIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLN
FT                   SKYKDMFIRINDFFPPGRPNEKDLDLIYKRKDKAPFQEVEFADGGTELVWNTFGEEQID
FT                   LDVTAEVTKEFIRQTIKNMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKA
FT                   EAAKYDMELLPEIHEHYSIQMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSP
FT                   MKQFTTLDTHDGIGVVDARDLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQIN
FT                   STYYSALGDDDKSYLLARVIQCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYY
FT                   TIDEIKNEVKRPVVKALCNLLRFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITA
FT                   TLKANLSTKTFQISENERNILI"
     ttgcaaatta aaaataaagc tatgttaatt acttattctg atagtttagg gaaaaatatg        60
     gaagaattat ccaaggtgat ggaaacttat tttgaagatg ctgttggcgg gattcactta       120
     ttgccgttct ttccatccac tggagatcga gggtttgcgc caagtgatta cacaacagta       180
     gatagcgacc taggttcttg ggaaataatc gagaaattag gcgaaaagta ttatttaatg       240
     tttgatttta tgattaatca catttctcgc gaatcactct tctttcaaga ttttaaaaaa       300
     gagcatttaa actcaaagta taaagatatg tttattcgta tcaatgattt ctttcctccg       360
     ggtagaccaa atgaaaaaga cttagattta atttataaga gaaaagataa ggcgcctttt       420
     caagaagttg aatttgctga tgggggaacg gaattagttt ggaatacttt tggggaagaa       480
     caaattgatt tagatgtgac agccgaagtt acaaaagaat ttattcgtca aacgataaaa       540
     aatatggctg cacatggttg ttctattttg cgtcttgatg cctttgctta tgcaattaaa       600
     aaattagata caaatgattt ttttgtagaa ccggaaattt gggatttact ggatgaagtg       660
     aaagcagaag cggccaaata tgacatggaa ttattaccag aaattcatga acattattcc       720
     atccaaatga aaatcgcgaa ccatgattat tatatctatg attttgcgtt acccatggtg       780
     atgctgtact cgttatatag tggccgagtg gaacgtttag ctaaatggtt agaaatgagt       840
     ccgatgaagc aatttactac tttagatacg catgatggca ttggcgttgt ggatgcacgc       900
     gatttattaa cagatgagga actcgattat acttcagcag aattatacaa aataggagct       960
     aatgttaaaa agatatattc ctctgaaaaa tataataacc tggatattta tcaaattaat      1020
     agtacctatt atagtgcttt gggtgacgat gataaaagtt acttgttagc gagagtaatt      1080
     caatgttttg cgccggggat tccgcaaatt tattatgttg gtttacttgc tggcaaaaat      1140
     gatattgacc ttttagagga aacaaaagaa gggcgtaata ttaatcgtca ttactacaca      1200
     atagatgaaa ttaaaaatga agtaaaaaga ccagttgtta aagcgttgtg caatttactg      1260
     aggtttagaa atacttctga agcgtttgat ttggaaggaa gtatagaaat tgagacacct      1320
     agctcaaatg aaatcgttat tattcgcaaa aacaaaacaa ataaaattac agcgacatta      1380
     aaagcaaatt taagtactaa aacattccaa atcagcgaaa atgaaagaaa tattttaatt      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page