(data stored in ACNUC10821 zone)

EMBL: AE017262.GYRA

AE017262.GYRA        Location/Qualifiers
FT   CDS_pept        8065..10593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="LMOf2365_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P05653; match to
FT                   protein family HMM PF00521; match to protein family HMM
FT                   PF03989; match to protein family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02797"
FT                   /protein_id="AAT02797.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHDPDITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYHYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
     atggcagaaa caccaaatca acgaataaca gagataaact taaataaaga aatgcggaca        60
     tcattcctgg actatgcgat gagtgtaatt gttgcccgtg ccctaccaga cgttcgtgac       120
     ggattaaaac cagttcatcg tcgtattcta tatgcgatga atgacttagg tatgacttct       180
     gataaggcct ataaaaaatc agctcgtatc gttggtgaag taatcggtaa gtatcacccc       240
     cacggcgata cagcggttta ttttacaatg gttcggatgg cgcaagattt tagttaccgt       300
     aatatgctag ttgatggaca tggtaacttt ggttcggtcg atggcgatat ggcggcagcg       360
     atgcgttata cagaagcacg tatgtcaaaa atttcgatgg aacttcttcg cgatattaat       420
     aaagatacaa ttgattatgc tgataactac gatggttctg aacgtgagcc agtcatttta       480
     ccagcgcgtt tccctaactt acttgtcaat ggttcgtcag gtattgcggt tggtatggca       540
     acaaacattc ctacccacca tcttggtgaa gttatcgacg gcgttttagc gcttagtcat       600
     gatccggata ttactattcg tgatttaatg gaatatatcc ctggccctga cttccctact       660
     gctgggatga ttatggggcg tagcggaatc cgtcgcgctt acgaaagtgg ccgtggttcg       720
     attactgttc gtggtcgtgt cgatattgaa gaaaagaaaa atggtaaaga aacaatcgtt       780
     attaccgaaa ttccttacca agtaaataaa gcgcgcctag ttgagcgtat tgccgaacta       840
     gctcgtgaga agaaaatcga cggtatcact tccctaaacg atgaatctga ccgttctgga       900
     atgcgcattg ttattgaagt tcgtcgtgat attagtgcaa gtgttatcgt gaataattta       960
     ttcaaaatga cagcacttca aactactttt ggtattaata tgctcgcact tgtcgacaat      1020
     catccaaaag tacttaattt aaaagaaatt ctttatcatt atttagagca tcaaaaagta      1080
     gttattcgtc gccgtacgga atttgagctt cgtaaagcag aagcgcgcgc tcacatttta      1140
     gaaggtttac gaattgcact agataatatt gacgcgatta ttaaattaat tcgtggatca      1200
     aaaacttccg atgttgctaa agaaggcttg atgacacaat tcaacctttc ggacaaacaa      1260
     gcgcaagcca ttttagacat gcgtttgcaa cgtttaacag gtttggaacg cgaaaaaatt      1320
     gaagaagaat accaaaactt agtggcatta attaatgatt taaaagccat tttagctgat      1380
     gatgagcgta ttcttgaaat tattcgtgaa gaattagaag aaatcaaagt taaatacgcg      1440
     gataaacgtc gtacagaaat cttggctggt gatttagtaa gccttgaaga tgaagactta      1500
     atccctgaag aagaagtggc gattacacta actaaacgtg gctatattaa acgtttacca      1560
     ttatcaactt atcgtagcca acgtcgtggt ggtcgtggta tccaaggtat gtctactcat      1620
     gaagatgatt tcgtagaaca tcttgttgca acgagcacgc atgatacgtt actattcttc      1680
     actaacacag gtaaagttta ccgttcgaaa ggttatgaag tacctgaata cggtcgtacc      1740
     gccaaaggta tcccaatcat caacttactt ggaatcgaaa gccaagaaca agtgaatgcc      1800
     gtgataaatc tatccgaatt cactgatgat agctacctat tctttactac taaacacggt      1860
     gtcgtgaagc gtacaaccct ttctcaattt gcgaaaattc gtcaaagtgg tcttcgtgca      1920
     gttgaacttc gcgaaaacga tgaactaatc tctgttcaga tgacagatgg tagcaaaaac      1980
     atgattatcg caacgaaaca tggacaatct atctacttcc cagaagaaaa tatccgcgta      2040
     atgggccgta cagctgctgg tgttcgtggt attagacttc gtgaagacga tgaagttatc      2100
     ggtatggaag tccttgagga tgatgaaaaa gttctcgttg taacggaaaa aggatacggt      2160
     aaacaaacac cggcttccca gtacccgctt cgtaatcgcg gtggtatggg tgttaaaacc      2220
     gttacaatca cagagaaaaa tggtaactta gtcgcaatga aaacagtgac tggtgaagaa      2280
     gacttaatgc taatgacagt aagtggcgta ttaattcgtt tcgaaattga tacagtatca      2340
     caaacaggtc gtagcgcaat gggtgtcaaa ctaattcgtc ttgatgaaga tgaaaaagta      2400
     gctactgttg caaaagtgcc aaaagaagaa gatgaagttg agcttgagga agaaatcgat      2460
     gaaacattaa tcacacaagt tcctgatgaa agttttgaag atgctcctgg aagcgatata      2520
     gaagaataa                                                              2529
//

If you have problems or comments...

PBIL Back to PBIL home page