(data stored in ACNUC10821 zone)

EMBL: AE017262.HISA

AE017262.HISA        Location/Qualifiers
FT   CDS_pept        complement(608810..609532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="LMOf2365_0593"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="identified by similarity to SP:O35006; match to
FT                   protein family HMM PF00977; match to protein family HMM
FT                   TIGR00007"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03375"
FT                   /db_xref="GOA:Q722Y6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y6"
FT                   /protein_id="AAT03375.1"
FT                   /translation="MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGAT
FT                   YLHIVDLDGALEGRPINLEIIQRMKKAAKIPVQVGGGIRSMAQVDYYLESGIDRVIIGS
FT                   AALTNPDFLRAAVQKYGAKIVAGIDAKNGFVATRGWLDVSQVSYLDLAKRMEKVGVETI
FT                   IYTDISRDGTLTGPNLEQMANLKEHVKVSLIASGGVSSRADLEALAQLGLYGAIAGKAL
FT                   YNHDISMSDIVEVEQIAY"
     atgcaaatct tcccagcaat agacttaaaa aatggacagt gcgtccgtct cttccaaggc        60
     gacttctcta aaaaaacagt tgtcaatgaa gacccaattg cccaagcaaa agcatttgct       120
     acagacggcg caacctattt gcacatcgtc gacctagacg gtgcattaga aggacgtcct       180
     atcaatctag aaattattca aaggatgaaa aaagcagcta aaatccctgt tcaagttggt       240
     ggaggaattc gtagcatggc gcaagtggat tattatcttg aatccggcat cgaccgcgtg       300
     attatcggtt ctgccgctct aacaaatcca gatttcctac gtgcggcagt ccaaaaatac       360
     ggagctaaaa ttgtagcagg tatcgatgcc aaaaacggtt ttgtcgcaac aagaggttgg       420
     ctcgatgtca gtcaggtaag ctatttagat ttggctaaac gaatggaaaa agtgggtgtt       480
     gagacaatca tttacactga tattagccgt gatggcacgc taactggacc taatttagaa       540
     caaatggcaa atctcaaaga gcacgttaaa gttagtttaa ttgcttctgg cggagtgagc       600
     agtcgtgcag atttggaagc actcgcccaa ctcggcttat atggagcaat tgccggaaaa       660
     gccctttata atcatgatat ttccatgtca gatattgtag aggtggaaca aattgcttac       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page