(data stored in ACNUC10821 zone)

EMBL: AE017262.HISD

AE017262.HISD        Location/Qualifiers
FT   CDS_pept        complement(610723..612006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="LMOf2365_0596"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="identified by similarity to SP:O34651; match to
FT                   protein family HMM PF00815; match to protein family HMM
FT                   TIGR00069"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03378"
FT                   /db_xref="GOA:Q722Y3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y3"
FT                   /protein_id="AAT03378.1"
FT                   /translation="MKILTGTVNELLNELKIETDTNTSIQVETEVKTIIEKVKTAGDQA
FT                   LFDFTSKFDGVGLTELRVPAADIQAASAKIEPAFLDALQQAKVNIESFHSKQKQHAFLD
FT                   SEKDGVIRGQLIRPLETVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPGENGI
FT                   NPYVLASAQLAGVDEIYQVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGL
FT                   VDIDMIAGPSEIVVLADENANPAFIAADLLSQAEHDILARAILITTSKKIAEETQNEID
FT                   KQLENLPRKAIAQKSIETRGKIIIAATTQEMFDIMNEIAPEHLEVQLENPMNYLYQIKN
FT                   AGSIFLGSYASEPLGDYFAGPNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKE
FT                   KDAIVLLAKKEGLDAHAKAIQIRFEEEN"
     atgaaaattt taaccggaac agtaaatgag ctattaaacg agctcaaaat agaaactgat        60
     acgaacactt ccatccaggt ggaaaccgaa gtaaaaacga ttatcgaaaa agtcaaaaca       120
     gctggcgacc aagccctatt tgacttcaca tccaagtttg acggcgtagg gctcaccgaa       180
     ctccgcgttc cagccgctga catccaagct gcaagcgcaa aaatcgaacc tgccttctta       240
     gacgcgctcc aacaagcaaa agtaaatatc gaaagtttcc acagcaagca aaaacaacat       300
     gctttccttg atagtgaaaa agacggcgtc attcgagggc aattaattcg tccactagaa       360
     accgtcggcg tttacgttcc cggtggcaca gcagcctatc cttcatcggt tttaatgaat       420
     gtgttgccag ccaaaattgc cggagtaaag cgaatcgtaa tgattacccc tcccggtgaa       480
     aacggtatta atccttacgt tctagcctca gctcaactag ctggtgtgga cgaaatttac       540
     caagttggcg gtgcacacgg aatcgccgct ctagctcacg gaacagaatc tatccctaaa       600
     gtagataaaa tcgtcggtcc tggaaatatc tatgtcgcca ctgccaaacg tgaagtattc       660
     ggcttagttg atattgacat gatagccggt ccatccgaaa tcgtcgtgct cgcagatgaa       720
     aacgccaatc ctgcttttat cgcagccgac ttactctccc aagcagagca cgatatttta       780
     gcccgtgcta tcttaatcac aactagtaaa aaaatcgccg aggaaacaca aaatgaaatt       840
     gacaaacagc tagaaaatct accgcgaaaa gcgattgctc agaaatctat cgaaacacga       900
     ggaaaaatca ttatcgcagc aaccacacaa gaaatgttcg atatcatgaa cgaaatcgcc       960
     ccagaacact tagaagtaca acttgaaaat ccgatgaact atctctatca aattaaaaac      1020
     gctggctcca ttttcttagg gagttatgca tcggaacctc ttggcgacta ttttgctggc      1080
     ccaaatcacg tcttacctac aagtggtacc gcaaaattct tctctcctct tggtgttgaa      1140
     gattttacca aacgttccgc ctttatttct tatacaaaag aagcactcgc aaaggaaaaa      1200
     gatgctatcg ttttacttgc taaaaaagaa ggtctagacg cccatgccaa agccattcaa      1260
     attcgttttg aggaggaaaa ctaa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page