(data stored in ACNUC10821 zone)

EMBL: AE017262.HLY

AE017262.HLY         Location/Qualifiers
FT   CDS_pept        211179..212768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hly"
FT                   /locus_tag="LMOf2365_0213"
FT                   /product="listeriolysin O"
FT                   /note="identified by similarity to SP:P13128; match to
FT                   protein family HMM PF01289"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03000"
FT                   /db_xref="GOA:Q724L1"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L1"
FT                   /protein_id="AAT03000.1"
FT                   /translation="MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENLISSIAPPASP
FT                   PASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKK
FT                   KKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTN
FT                   QDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFG
FT                   TAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQA
FT                   LGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKN
FT                   SSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAV
FT                   IKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEINYDPEGNEIVQHKNWSENNK
FT                   SKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLY
FT                   PKYSNSVDNPIE"
     atgaaaaaaa taatgctagt ttttattaca cttatattag ttagtctacc aattgcgcaa        60
     caaactgaag caaaggatgc atctgcattc aataaagaaa atttaatttc atccatagca       120
     ccaccagcat ctccgcctgc aagtcctaag acgccaatcg aaaagaaaca cgcggatgaa       180
     atcgataagt atatacaagg attggattac aataaaaaca atgtattagt ataccacgga       240
     gatgcagtga caaatgtgcc gccaagaaaa ggttataaag atggaaatga atatatcgtt       300
     gtggagaaaa agaagaaatc catcaatcaa aataatgcag atatccaagt tgtgaatgca       360
     atttcgagcc taacatatcc aggtgctctc gtgaaagcga attcggaatt agtagaaaat       420
     caacccgatg ttcttcctgt caaacgtgat tcattaacac ttagcattga tttgccagga       480
     atgactaatc aagacaataa aattgttgta aaaaatgcta ctaaatcgaa cgttaacaac       540
     gcagtaaata cattagtgga aagatggaat gaaaaatatg ctcaagctta tccaaatgta       600
     agtgcaaaaa ttgattatga tgacgaaatg gcttacagtg aatcacaatt aattgcaaaa       660
     tttggtacgg catttaaagc tgtaaataat agcttgaatg taaacttcgg cgcaatcagt       720
     gaagggaaaa tgcaagaaga agtcattagt tttaaacaaa tttactataa cgtgaatgtt       780
     aatgaaccta caagaccttc cagatttttc ggcaaagctg ttactaaaga gcagttgcaa       840
     gcgcttggag tgaatgcaga aaatcctcct gcatatatct caagtgtggc atatggccgt       900
     caagtttatt tgaaattatc aactaattcc catagtacca aagtaaaagc tgcttttgac       960
     gctgccgtaa gtgggaaatc tgtctcaggt gatgtagaac tgacaaatat catcaaaaat      1020
     tcttccttca aagccgtaat ttacggtggc tccgcaaaag atgaagttca aatcatcgac      1080
     ggtaacctcg gagacttacg agatattttg aaaaaaggtg ctacttttaa ccgggaaaca      1140
     ccaggagttc ccattgccta tacaacaaac ttcttaaaag acaatgaatt agctgttatt      1200
     aaaaacaact cagaatatat tgaaacaact tcaaaagctt atacagatgg aaaaatcaac      1260
     atcgatcact ctggaggata cgttgctcaa ttcaacatct cttgggatga aataaattat      1320
     gatcctgaag gtaacgaaat tgttcaacat aaaaactgga gcgaaaacaa taaaagtaag      1380
     ctagctcatt tcacatcgtc catctatttg ccaggtaacg caagaaatat taatgtttac      1440
     gctaaagaat gcactggttt agcttgggaa tggtggagaa cggtaattga tgaccggaac      1500
     ctaccgcttg tgaaaaatag aaatatctcc atctggggca ctacacttta tccgaaatat      1560
     agtaatagtg tagataatcc aatcgaataa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page