(data stored in ACNUC10821 zone)

EMBL: AE017262.HOLB

AE017262.HOLB        Location/Qualifiers
FT   CDS_pept        171698..172690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="LMOf2365_0177"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P37540; match to
FT                   protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02964"
FT                   /protein_id="AAT02964.1"
FT                   /translation="MGLQDELTVMQPVVMKIFSKSVRENRLSHGYLFEGARGTGKKRTA
FT                   LWLAQSLFCLESTETELTCGKCANCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEEAKAFEESEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
     gtgggattac aggatgaact tacagtgatg caaccagtgg tcatgaagat tttttcaaaa        60
     agtgtccgcg aaaatcgatt atctcacggc tatttattcg aaggagcaag aggtacaggt       120
     aagaaacgca cagcactttg gttagctcag agtctttttt gtttagaaag cactgaaacc       180
     gagcttactt gtgggaagtg tgccaattgc acgagaatag caagtcataa tcatccggat       240
     gttcatttgc tagagccaga tggagctagt attaagattg atcaggttcg cgcgctgaag       300
     caagaactta gtaaacgcgg aatggaatcg gatcaaaaag tagttatcat ttacgatgca       360
     gaaaaaatga ctgttcaatc agccaatagt ctgctgaaat ttatagaaga accagaaggc       420
     ggtttgttat tattattttt aacaacaaac cccgggcaaa ttttgccaac gattcaatca       480
     agactgcaac ctgtcacatt caaatcactg acttttgata gtttactcgc atcactaaca       540
     gcagcaggca tttccgaaca aaaagcgcgg atttatgcta gcattactgg gagtgtggaa       600
     gaagcgaagg cttttgaaga gagtgagtgg tttagtgagg caagaaatgt tgtcatcaag       660
     ttatatgaag gaattcacca tcaaggaacc agcccattaa ttatcattca agaatcatgg       720
     atgccacttt ttaaagagaa agataagatg gcgcttgggc tcgaattatt gttactgctg       780
     taccgcgacc ggctacacct tacacttgac gagaactacg aacctatttg tactgcgcaa       840
     aaagaaatgc tcggacaaga tgcgctgcgt aaatcactgt ccgaaaccac aggggaaatc       900
     gagaagattc tcgctgcgaa atcaaaactg gattccaata tgaacacgca acttctaatg       960
     gagcagttag ttctggaaat ccaagggagg taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page