(data stored in ACNUC10821 zone)

EMBL: AE017262.INLA

AE017262.INLA        Location/Qualifiers
FT   CDS_pept        484412..486814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlA"
FT                   /locus_tag="LMOf2365_0471"
FT                   /product="internalin A"
FT                   /note="identified by similarity to SP:P25146; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF00746; match to protein family HMM PF08191; match to
FT                   protein family HMM TIGR01167; match to protein family HMM
FT                   TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03255"
FT                   /db_xref="GOA:Q723K6"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723K6"
FT                   /protein_id="AAT03255.1"
FT                   /translation="MRRKRYVWLKSILVAILVFGSGVWINTSNGTNAQAATITQDTPIN
FT                   QIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGLEYLNNLTQIN
FT                   FSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLSNLTGLTLFNNQITDIDPLKNL
FT                   TNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI
FT                   SVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLA
FT                   NNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKN
FT                   LTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLT
FT                   PLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGSYAEPDI
FT                   TWNLPSYTNEVSYTFNQSVTIGKGTTTFSGTVTQPLKAIFNAKFHVDGKETTKEVEAGN
FT                   LLTEPAKPVKEGYTFVGWFDAQTGGTKWNFSTDKMPTNDIDLYAQFSINSYTATFDNDG
FT                   VTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSA
FT                   NSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPA
FT                   NDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTST
FT                   MNAYDPYNSKEASLPTTGDSDNALYLLIGLLAVGTAVALTKKARASK"
     gtgagaagaa aacgatatgt atggttgaaa agtatactag tagcaatatt agtatttggc        60
     agtggagtat ggattaacac gagtaacggg acaaatgctc aggcagctac aattacacaa       120
     gatactccta ttaatcagat ttttacagat acagctctag cggaaaaaat gaagacggtc       180
     ttaggaaaaa cgaatgtaac agacacggtc tcgcaaacag atctagacca agttacgacg       240
     cttcaggcgg atagattagg gataaaatct atcgatggat tggaatactt gaacaattta       300
     acacaaataa atttcagcaa taatcaactt acggacataa ctccacttaa agatttaact       360
     aagttagttg atattttgat gaataataat caaatagcag atataactcc gctagctaat       420
     ttgtcgaatc taactggttt gactttgttc aacaatcaga taacggatat agacccgctt       480
     aaaaatctaa caaatttaaa tcggctagaa ctatctagta acacgattag tgatattagt       540
     gcgctttcag gtttaactag tctacagcaa ttatcttttg gtaatcaagt gacagattta       600
     aaaccattag ctaatttaac aacactagaa cgactagata tttcaagtaa taaggtgtcg       660
     gatattagtg ttctggctaa attaaccaat ttagaaagtc ttatcgctac taacaaccaa       720
     ataagtgata taactccact tgggatttta acaaatttgg acgaattatc cttaaatggt       780
     aaccagttaa aagatatagg cacattggcg agtttaacaa accttacaga tttagattta       840
     gcaaataacc aaattagtaa tctagcacca ctgtcgggtc taacaaaact aactgagtta       900
     aaactgggag ctaaccaaat aagtaacatc agtcccctag caggtctaac cgcactcact       960
     aacttagagc taaatgaaaa tcagttagaa gatattagcc caatttctaa cctgaaaaat      1020
     ctcacatatt taacgttgta ctttaataat ataagtgata taagcccagt ttctagttta      1080
     acaaagcttc aaagattatt tttctataat aacaaggtaa gtgacgtaag ctcacttgcg      1140
     aatttaacca atattaattg gctttcggct gggcataacc aaattagcga tcttacacca      1200
     ttggctaatt taacaagaat tacccaatta ggattgaatg accaagaatg gacaaatcca      1260
     ccagtgaact acaaagtaaa tgtatccatt ccaaacacgg tgaaaaatgt gacgggcgct      1320
     ttgattgcac cagctactat tagcgatggt ggtagttatg cagaacctga tataacatgg      1380
     aatttaccta gttataccaa tgaagtaagt tataccttta accaatctgt caccattgga      1440
     aaaggaacga caacatttag tggaactgtg acgcagccac ttaaggcaat ttttaatgct      1500
     aagtttcatg tggacggcaa agaaacaacc aaagaagtgg aagctgggaa tttattgact      1560
     gaaccagcta agcctgtaaa agaaggttat acatttgttg ggtggtttga tgcccaaacc      1620
     ggcggaacta aatggaattt cagtacggat aaaatgccga caaatgacat cgatttatat      1680
     gcgcaattta gtattaacag ctacacagca acgtttgata atgacggtgt aacaacatct      1740
     caaacagtag attatcaagg cttgctacaa gaacctacgg caccaacaaa agaaggttat      1800
     actttcaaag gctggtatga cgcaaaaact ggtggtgaca agtgggattt tgcaactagt      1860
     aagatgcctg ctaaaaacat caccttatat gctcaatata gcgccaatag ctatacagca      1920
     acctttgatg ttgatggaaa aacaacgact caagcagtag actatcaagg acttctaaaa      1980
     gaaccaaaaa cgccaacaaa agccggatat actttcaaag gttggtatga cgaaaaaaca      2040
     gatggtaaaa aatgggattt tgcgacagat aaaatgccag caaatgatat tacgctgtac      2100
     gctcaattca cgaaaaatcc tgtggcacca ccaacaactg gagggaacac tccgccgact      2160
     acaaataacg gagggaacac tacaccacct tccgcaaata tacctggaag caacacatct      2220
     aacacatcaa ctgggaattc agctagcaca acaagtacaa tgaacgctta tgacccttat      2280
     aattcaaaag aagcttcact ccctacaact ggtgatagcg ataatgcgct ctacctgttg      2340
     ataggattgt tagcagtagg aactgcagtg gctcttacta aaaaagcacg tgctagtaaa      2400
     tag                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page