(data stored in ACNUC10821 zone)

EMBL: AE017262.INLC2

AE017262.INLC2       Location/Qualifiers
FT   CDS_pept        297720..299366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlC2"
FT                   /locus_tag="LMOf2365_0281"
FT                   /product="internalin C2"
FT                   /note="identified by similarity to GP:2347104; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03068"
FT                   /protein_id="AAT03068.1"
FT                   /translation="MKKRWNSVFKLVLMVAAILGISLYVTTSQGAEVRAESIAQPTPIN
FT                   VIFPDPALANAVKTATGKSNVTDAVTQADLDGIATLSAFNTGVTTIEGIQYLNNLIGLE
FT                   LKDNQITDLTPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGL
FT                   SNLQVLYLDLNQITNISPLAGLTNLQYLSIGNNQVNDLTPLANLSKLTTLRADDNKISD
FT                   ISPLASLPNLIEVHLKDNQISDVSPLANLSNLFIVTLTNQTITNQPVYYQNNLVVPNVV
FT                   KGSSGAPIAPATISDNGTYASPNLTWNLTSFINNVSYTFNQSVAFKNTTVPFSGTVTQP
FT                   LTEAYTAVFDVDGKQTSVTVGANELIKEPTAPTKEGYTFTGWYDAKTGGNKWDFSTDKM
FT                   PAENITLYAQFTINSYTATFDNDGKITTQKVTYQSLLEEPAAPTKAGYTFKGWYDAKTG
FT                   GTKWDFATGKMPAGNITLYAQFTKNDSPNPNDPTPNTPTGNGDGTSNPSDSGGNTTLPT
FT                   AGDENTMLPIFIGVFLLGTATLILRKTIKVK"
     atgaaaaaac gatggaattc tgtatttaaa ctagttttaa tggtagctgc tattctcggt        60
     attagtctat atgtaacgac aagtcaaggt gcggaggttc gcgcggaaag cattgcgcag       120
     ccaaccccaa ttaatgttat tttccctgat ccggctcttg cgaatgcagt taaaacagcg       180
     actggaaaat ctaatgtaac agacgctgtt acgcaagcag atttagatgg aatagctact       240
     ttatcagcat ttaatactgg agtaacaacg atagaaggaa tacaatactt aaataatttg       300
     atagggttag aacttaaaga taaccaaata actgatttaa ctcctcttaa aaatttaacg       360
     aaaataacag agcttgaatt atctggaaat ccgttaaaaa atgtgagcgc gattgctggg       420
     ttacaaagca ttaaaacgct agatttaact tctacacaaa ttacagatgt gactccactt       480
     gcaggtcttt ccaatttgca ggtattatat ttggacctca atcaaataac caatataagt       540
     ccgctcgcag gactaactaa tttacaatac ttatcaatcg gaaataacca agtaaatgat       600
     ttaaccccac ttgctaattt atctaaacta acgactttaa gagctgatga taataaaata       660
     agtgatattt cgccacttgc gagtttacct aaccttatag aagttcattt gaaagataat       720
     caaattagtg atgtcagccc acttgctaat ttatcgaact tatttatagt cactttaaca       780
     aatcaaacaa ttaccaacca acccgtgtat tatcaaaata atcttgtcgt tcctaatgta       840
     gtaaaaggtt cttctggcgc gcctattgca cctgctacta ttagcgacaa tggaacatac       900
     gctagtccaa atttaacatg gaatttaact agttttatta ataatgttag ctacacgttt       960
     aaccaatcag tcgctttcaa aaatacaacg gttcctttca gtggaacagt tacccaacca      1020
     ttaacagaag cttacactgc ggtttttgat gtggatggaa aacaaacaag tgtgacagtc      1080
     ggcgcgaatg aattaattaa agaaccaaca gcaccaacga aagaaggtta cacattcaca      1140
     ggctggtatg atgccaaaac tggcgggaat aaatgggatt tcagcacgga caaaatgcca      1200
     gcagaaaata tcacattgta tgcgcagttc acgattaata gctatactgc cacatttgac      1260
     aatgatggaa aaataacgac gcaaaaagtc acttatcaaa gtctgttaga agaaccagca      1320
     gcgccaacga aagcaggtta tacgttcaaa ggttggtacg atgctaaaac gggtggaact      1380
     aaatgggatt ttgctactgg taaaatgccg gcgggaaata ttacactata tgcccaattc      1440
     actaaaaatg atagcccaaa tccaaatgat ccaactccta ataccccaac aggaaatggt      1500
     gatggtacaa gtaatccaag tgattcaggc ggtaatacca cacttccaac agctggggac      1560
     gaaaatacta tgcttccaat ttttatcgga gttttcttgt tagggacagc aacgctaatt      1620
     ctccgcaaaa caatcaaagt gaaataa                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page