(data stored in ACNUC10821 zone)

EMBL: AE017262.INLE

AE017262.INLE        Location/Qualifiers
FT   CDS_pept        301493..302992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlE"
FT                   /locus_tag="LMOf2365_0283"
FT                   /product="internalin E"
FT                   /note="identified by similarity to GP:2347106; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR01167; match to
FT                   protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03070"
FT                   /protein_id="AAT03070.1"
FT                   /translation="MKRNKVILRIVVTLAAVLAITFWVGMSSKEVQAAVIEQPTPINEI
FT                   FTDPVVADNVKTLLEKADVTDEVTQTDLDSITQLSAKSAGITTIEGMQYLTNLSELELT
FT                   DNQITDVSPLANLTKITELGLSGNPLKDVSALAGLKSLKMLHLIYTDITDVTSLAGLTN
FT                   LQELNLDINQITDISPLAALSNLQTLSLGYTQVSDLTPIANLSKLTILNAENCKVSDIS
FT                   PLASLSSLTEVYLRENQISDVSPLANIPNLSIIELTDQIITNQPVYYQNKIIVPNVIKG
FT                   LSGELIAPDTISDNGTYTSPDLTWDLNSYINSVSYTFNQSVVFKNATVPFSGTVTQPLT
FT                   EAYTAVFDVDGEQTSLTVVVNELIEEPTVPTKEGYTFDGWYDAETNGNKWDFAVDKMPA
FT                   SDITLYAKFTENEEPNASSSINVEPNDDNSITVEPDASNSITVKPTENNDGTNNPNSSS
FT                   DDKVNIKLPITGDEWNVLPIFVGAVLIGMGLVLFRKKRQTK"
     atgaaaagaa acaaagtaat attaagaatc gtagtgactt tagcagcagt attggcaatt        60
     actttttggg ttgggatgag ctcaaaagaa gtacaagcag cggtaattga acaaccaacc       120
     cctatcaatg aaatttttac tgatccagtg gttgctgata atgtgaaaac acttctcgaa       180
     aaagcggatg taacagatga agttacgcaa actgatttag atagtataac ccaattatca       240
     gcaaaatctg cgggaataac aacgatagaa ggaatgcagt acttaactaa tttatcagaa       300
     ctagaactaa cagataacca aataaccgat gtaagtccgc tcgcaaattt aacgaaaata       360
     acagagcttg gattatccgg aaatccatta aaagatgtaa gtgcgcttgc gggattaaaa       420
     agtctaaaaa tgttgcatct tatttataca gatattaccg atgtgacttc ccttgcaggt       480
     cttaccaatt tgcaggaatt aaatttggat atcaatcaaa taacggatat aagtccacta       540
     gcagctttat ctaacttgca aacattatca ctcggatata cccaagtgag cgatttaacc       600
     ccaattgcta atttatctaa actaaccata ttaaacgctg aaaattgtaa agtaagcgat       660
     atctcgccac ttgcaagttt atctagtctt acagaagttt acttgagaga gaatcaaatt       720
     agcgatgtga gtccccttgc gaatattccc aacttatcta ttattgagtt gacggatcaa       780
     ataattacca accaacccgt atattatcaa aataaaatca ttgttccaaa tgtgataaaa       840
     ggcctttctg gtgagcttat tgcacctgat actattagtg acaatggaac atatactagt       900
     cctgatttaa cgtgggattt aaacagctac attaatagtg ttagttacac atttaaccaa       960
     tcagtcgttt tcaaaaatgc aacagttcct ttcagtggaa cagtcaccca accattaaca      1020
     gaggcttaca ctgccgtttt tgatgtggac ggagagcaaa caagtttgac agtagttgtg      1080
     aatgaattaa ttgaagaacc aacagttcca accaaggaag gatatacatt cgatggctgg      1140
     tatgacgcag aaacgaatgg gaataaatgg gactttgcgg tagataaaat gcctgctagt      1200
     gatataactt tatatgctaa gttcactgag aacgaagaac caaatgctag tagttcaatt      1260
     aatgtggaac caaacgatga taattccatc actgtagaac ccgacgctag caattccatc      1320
     actgtaaaac caacagaaaa taacgatgga acaaataatc cgaacagttc aagtgatgat      1380
     aaagttaaca tcaagttacc aattactggg gacgaatgga atgtgcttcc catttttgta      1440
     ggagcagttc ttatcggtat gggcttagtt ttattccgca aaaaacgtca aacaaaataa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page