(data stored in ACNUC10821 zone)

EMBL: AE017262.ISPD

AE017262.ISPD        Location/Qualifiers
FT   CDS_pept        261061..261759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="LMOf2365_0247"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03034"
FT                   /db_xref="GOA:Q724H7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H7"
FT                   /protein_id="AAT03034.1"
FT                   /translation="MNYELVFLAAGQGKRMNAQKNKMWLELVGEPIFIHALRPFLADNR
FT                   CSKVIVVSQEEERKHVKELMSQLNVAESRIEIVKGGSERQYSVAAGLERCGTERVVLVH
FT                   DGARPFITLDIIDRLLIGVEQSKAAICAVKVKDTVKRVVKGVVQETVDRENLWQVQTPQ
FT                   AFELPILRKAHQLARKEQFLGTDEASLVERLPCPVAIVQGSYYNIKLTTPEDMPLAKAI
FT                   LGELGGIAND"
     atgaattatg agttggtttt tttagcggca ggtcaaggga aacgtatgaa tgcccagaaa        60
     aataaaatgt ggctagagtt agttggtgaa ccaattttca ttcatgcctt gcgtcctttt       120
     ttagcagata atcgttgttc caaagtgatt gttgtgagtc aagaagagga aagaaagcat       180
     gtgaaagaat taatgagtca gcttaacgtt gctgaaagcc gaattgagat tgtgaagggc       240
     ggaagtgaac gccaatatag tgtggcagca ggtcttgaac gttgtgggac ggagcgggtt       300
     gtcttagtac atgatggcgc aagaccgttt atcacgttag atattattga tcgattatta       360
     attggtgtag agcaaagtaa agccgcgatt tgtgcagtaa aagtaaaaga tacggtgaaa       420
     cgagtggtga aaggtgtcgt tcaagaaact gttgaccgtg aaaatctttg gcaagttcaa       480
     acgccgcaag cttttgaact gcctatttta cgaaaagcgc atcagcttgc tcgaaaagaa       540
     cagtttttag gaacggatga agctagtctg gttgagcgac ttccttgtcc tgttgctatt       600
     gtccaaggaa gctattataa tattaagctg acaactcctg aagatatgcc gctcgctaag       660
     gcgattttag gggaacttgg agggatagca aatgattag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page