(data stored in ACNUC10821 zone)

EMBL: AE017262.ISPF

AE017262.ISPF        Location/Qualifiers
FT   CDS_pept        261752..262225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="LMOf2365_0248"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03035"
FT                   /db_xref="GOA:Q724H6"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H6"
FT                   /protein_id="AAT03035.1"
FT                   /translation="MIRIGQGYDVHKLAYDRELIVGGIKIPYEKGLLGHSDADVLLHAI
FT                   TDAIIGAIGAGDIGHFFPDTDMAFKDADSAELLEEIWQKVEADGFRLGNLDATIIAEKP
FT                   KMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK"
     atgattagaa ttggccaagg ttatgatgta cataaacttg cttatgaccg agaactgatt        60
     gttggcggga ttaaaattcc ttatgagaaa gggttactag gtcacagtga tgcggatgta       120
     cttcttcatg ctattactga tgctatcata ggcgcaattg gcgctggtga tattggtcat       180
     ttttttccgg acacagatat ggcttttaaa gatgcggatt cagctgagct acttgaggaa       240
     atttggcaga aggtagaggc ggatggtttt cgtcttggaa atctagatgc tactattatt       300
     gctgaaaagc caaaaatggc gccatatgtg gagcaaatga agcttcgaat tgcggagttg       360
     ctacatgcgg attcagccca agttaatgta aaggcgacta cgacagagaa attagggttt       420
     actggtcggg aagaaggcat cgcaagtcta gccgttgtct tacttgaaaa ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page