(data stored in ACNUC10821 zone)

EMBL: AE017262.LDH-1

AE017262.LDH-1       Location/Qualifiers
FT   CDS_pept        complement(219743..220684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh-1"
FT                   /locus_tag="LMOf2365_0221"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="identified by similarity to SP:P33380; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866; match to protein family HMM TIGR01771"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03008"
FT                   /db_xref="GOA:Q724K3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K3"
FT                   /protein_id="AAT03008.1"
FT                   /translation="MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGD
FT                   AMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIV
FT                   DEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKV
FT                   DARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIIN
FT                   KKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHI
FT                   VEMNLNDKEKEQMKNSADTLKKVLDDAMKQID"
     atgaaagatc atcaaaaaat tattttagtt ggcgacggag cagttggttc tagttacgca        60
     tttgcttgtg taaacttaag cattggacaa gaatttggta tcattgacat agataaagac       120
     agaactattg gggatgcaat ggatttaagt catgccgttc cattttctac accgaagaaa       180
     atctactcag caaattatag cgactgccac gatgcggact tagttgttgt aactgccggg       240
     actgcacaaa aacctggtga aactcgttta gatttagtaa atcgtaatat taaaatcatg       300
     aaaggcatcg tggatgaagt aatggctagc ggatttgacg gtatcttctt aatcgcttct       360
     aacccagtag atatcttaac ttacgctaca tggaaattct caggtcttcc aaaagaacgt       420
     gttatcggtt ctggaacaag ccttgataca gcacgtttcc gtatgtcaat tgccgactat       480
     ctaaaagtag atgctcgtaa cgtccatggt tacatccttg gcgaacacgg cgatacagaa       540
     ttcccagcat ggagccacac aactgtcggc ggtcttccaa tcactgaatg gattagcgaa       600
     gatgaacaag gtgcaatgga tactattttc gtaagtgttc gtgatgcagc ttatgaaatt       660
     attaataaaa aaggcgctac attctacggt gttgctgcag ctctagctcg tattacaaag       720
     gcaattctaa ataacgaaaa tgcgatctta ccactttctg tttatctaga tggtcattat       780
     ggtatgaacg acatttatat cggcgctccc gcagtcgtta accgtcaagg cgttcgccat       840
     attgttgaaa tgaatttaaa cgacaaagaa aaagaacaaa tgaaaaactc tgcagataca       900
     cttaaaaaag ttctagacga cgcaatgaaa caaatcgact aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page