(data stored in ACNUC10821 zone)

EMBL: AE017262.LMAA

AE017262.LMAA        Location/Qualifiers
FT   CDS_pept        134957..135469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaA"
FT                   /locus_tag="LMOf2365_0136"
FT                   /product="prophage LambdaLm01, antigen A"
FT                   /note="identified by similarity to OMNI:NTL01LM0118; match
FT                   to protein family HMM TIGR02126"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02924"
FT                   /protein_id="AAT02924.1"
FT                   /translation="MAFEENLYCDYTPGAAKAVAGKDVILAVFNAAGDKLLAVAGQQGL
FT                   TVNRSKDSIEITSKDTVGGWKSKIGGMKEWSIENDGLYVADAESHKELAKYFESDSPVC
FT                   VKIINQASKKGLFGGLAIVADYSFEAPFDEAMTYSVKLDGMGALVDLTITEGGDQMPGE
FT                   TPVAPAE"
     atggcatttg aagagaattt atattgtgat tatacaccgg gagctgctaa agcggtcgcg        60
     gggaaagatg taattttagc agtttttaac gcagcggggg ataagctatt agcggttgcg       120
     gggcaacaag gtctaactgt aaaccgttct aaagatagca ttgaaattac atctaaagat       180
     acagttggcg gatggaaatc caaaattggc ggtatgaaag aatggtcaat tgaaaatgac       240
     ggattatatg tcgctgatgc agagtctcac aaagaattgg cgaaatattt cgaaagtgat       300
     agcccggttt gcgtgaaaat cattaatcaa gcatctaaaa aaggtctttt cggtggtttg       360
     gcaattgtag ctgactatag ttttgaagca ccttttgatg aagcgatgac ttactctgta       420
     aaactagacg gaatgggtgc gcttgttgat ttaacgatta ctgagggcgg agatcaaatg       480
     cccggcgaaa cacctgtagc accagcagaa taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page