(data stored in ACNUC10821 zone)

EMBL: AE017262.LMAB

AE017262.LMAB        Location/Qualifiers
FT   CDS_pept        134555..134944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaB"
FT                   /locus_tag="LMOf2365_0135"
FT                   /product="prophage LambdaLm01, antigen B"
FT                   /note="identified by similarity to OMNI:NTL01LM0117"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02923"
FT                   /protein_id="AAT02923.1"
FT                   /translation="MKSLSFMRVLEAVRTMLQEKGGLDVSIVMRDQVEMPTTMIEMIDQ
FT                   EEEESQTAWKEKYRFAIHHYTNETDLAGVEMIDTLIQTGFTLPEGYKLIAVRHYGKQNL
FT                   VKENTLIHAKTSFEVSICRELKVKI"
     gtgaagagtt taagcttcat gagagttttg gaagcagtga gaacaatgct ccaggaaaaa        60
     ggcggactag atgtttctat tgtaatgcgt gaccaagtgg aaatgcctac aacgatgatc       120
     gagatgattg atcaagagga agaagaaagc caaactgcct ggaaagaaaa ataccgtttt       180
     gcaatccatc attatacaaa tgaaacggac ttagcgggag tcgaaatgat agatacgctt       240
     atccaaacag ggttcacttt gcctgaagga tacaaattaa tcgctgttcg acattacgga       300
     aaacaaaatt tagtcaaaga aaatacgtta attcacgcaa aaaccagttt tgaagtaagt       360
     atttgtcgtg aattaaaagt aaaaatttag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page