(data stored in ACNUC10821 zone)

EMBL: AE017262.LYSS

AE017262.LYSS        Location/Qualifiers
FT   CDS_pept        240787..242283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="LMOf2365_0240"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM PF01336; match to protein family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03027"
FT                   /db_xref="GOA:Q724I4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724I4"
FT                   /protein_id="AAT03027.1"
FT                   /translation="MSNENHEELNDQLIVRREKVDTLREEGIDPFGEKFIRSISPEEIE
FT                   TKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAY
FT                   AVFKLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHN
FT                   ALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDY
FT                   EDVMDLVEGLVSTVCKQVNGTTEITYGEYNVDLTPNWRRIHMADAVKEYVGVDFWNVTS
FT                   DEEARELAKKHNVPVTEHMTYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKE
FT                   DDRFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEAL
FT                   EYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHRD"
     atgagtaacg agaatcatga agaactaaat gaccaactca tcgtccgtcg cgaaaaagtg        60
     gacacattac gcgaagaagg catagatcct tttggcgaaa aattcatccg ttccatcagc       120
     ccggaagaaa ttgaaacaaa attcgctgat aaatcaaaag aagaacttga agaagctgct       180
     attgaagttt ctgtagcagg tcgtattatg acgaaacgtg tgaaaggtaa agtaggtttc       240
     acacatattc aagaccgttt ccatcaatta caaatctata tccgtaaaga tgcaattggc       300
     gaagatgctt atgcagtctt caaattagcg gatctaggtg acattattgg tataaaaggg       360
     actattttcc gtactaatac aggtgaactt tctgttaaag caacggaatt cactttgctt       420
     tccaaatcat tacgtccact tcctgataaa tatcatggct taaaagacgt agaacaacgc       480
     tatcgtcaac gctatttaga cttaattaca aacgaagaaa gccaaaatcg ttttgtgatg       540
     cgcagtaaaa tcttgaaata cactcgtgat tacatggata atcaaggatt cctagaagta       600
     gaaactccag tgcttcatac aattgctggt ggtgctgctg caaaaccatt tattacgcac       660
     cataatgcac ttgatatgga attatattta cgaattgctt tagaactaca cttaaaacgc       720
     ctaatcgttg gtgggatgga taaagtatac gaaatcggcc gcgttttccg taatgaagga       780
     acctccacgc gtcataaccc agaatttaca atgttagaat cctatgcagc atacgaagat       840
     tacgaagatg ttatggattt ggtagaaggt ttagtatcta cagtatgcaa acaagtaaat       900
     ggaacaacag aaataacata cggtgaatac aatgtagatc taactccaaa ctggcgccgt       960
     atccacatgg cagatgctgt aaaagaatat gtcggagtgg atttctggaa cgtaacttcc      1020
     gatgaagaag cacgcgaact agctaaaaaa cataatgtgc cagtaacgga gcacatgaca      1080
     tacgggcaca ttcttaatga gttttttgaa acatacgtag aagaaaagct tattcaacca      1140
     acctttgttt acggacatcc ggtggaaatt tcaccattag cgaagaaaaa caaagaagat      1200
     gaccgtttta ctgaccgttt tgaattattt atcgttggtc gtgaacatgc aaatgcattc      1260
     tcggaattaa acgatccaat tgatcaaaga gagcgttttg aagcgcaaat gaaagaacgt      1320
     gagcaaggta atgatgaagc gcacggaatg gatgcagatt tccttgaagc tttagaatac      1380
     ggtctaccgc cgactggtgg acttggaata ggtatcgatc gtctagtaat gctattaaca      1440
     gatgccccgt ctattcgtga tatcctatta ttcccaacta tgaaacaccg cgactaa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page