(data stored in ACNUC10821 zone)

EMBL: AE017262.MALL-1

AE017262.MALL-1      Location/Qualifiers
FT   CDS_pept        193224..194885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL-1"
FT                   /locus_tag="LMOf2365_0195"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number="3.2.1.10"
FT                   /note="identified by similarity to SP:P21332; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02982"
FT                   /protein_id="AAT02982.1"
FT                   /translation="MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKELG
FT                   VDVIWLSPVYDSPQDDNGYDIRDYQKIYEEYGDMATFDQLLQGLHDREMKLVMDLVVNH
FT                   TSDEHKWFEESRKSKDNPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSK
FT                   KQPDLNWENPKLRQDVYNMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVPDGQIYGDA
FT                   GNDFCNGPRIHEFLQEMNQEVTSKYDVMTVGEMPGASTTDAQIYTNPANNEVDMIFTFE
FT                   HMNLDSDGDNKWDLKPIYLPDLKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDN
FT                   RFRVRSAKMLATCLHMMKGTPYIYQGEEIGMTNVHFETLDDYRDIETLNMYKERKEQGH
FT                   SHESIMQSIYTKGRDNARTPYQWDNSENAGFTTGTPWLKVNPRYTEINNEEALKNPDSI
FT                   FYYYQNLIKLRKTTEIITTGNYRLLLPKDEAIFAYERYTENEKLVVLCNFTEEEQVISD
FT                   ENILNEIQKGSVLVNNVPNIIEGTLRPYEAIVYQIK"
     atgaaagaaa aagattggtg gaaaaaaagc gtagtgtacc aaatctatcc aaagagtttt        60
     aatgattcaa atggtgatgg agttggtgat attcaaggaa ttatcgagaa attagattat       120
     ttaaaagagc taggtgtgga cgttatctgg ttgtccccag tatacgattc gcctcaagat       180
     gacaatggtt acgatattcg cgattatcaa aaaatttacg aagagtatgg agatatggcg       240
     acttttgatc aattacttca aggtttacac gaccgcgaaa tgaaacttgt aatggatctt       300
     gttgttaacc atacttctga tgaacacaag tggtttgagg aatccagaaa atccaaagac       360
     aacccgtaca gagattacta tttctggcgc gaggaaaacg aaatcaataa ctggggctcg       420
     attttcagcg gtccagcatg ggaattggac gaaaaaacag gtgagtacta tttacaccta       480
     ttctccaaaa aacaacctga tttaaactgg gaaaacccta aattacgcca agatgtatat       540
     aatatgatga aattctggct agataaaggc attgatggct tccgcatgga tgtaattaat       600
     tttatttcca aaaatactga tttcccagat ggtccagtac cagatggtca aatttatggc       660
     gatgctggca atgatttttg taatggaccg cggattcatg agttcttgca agaaatgaac       720
     caagaagtta cttctaaata cgatgtgatg actgttggcg aaatgcctgg tgctagtaca       780
     accgacgcgc aaatttacac gaatccagca aataatgaag tcgatatgat ttttacattt       840
     gaacatatga acttagattc cgatggcgac aataaatggg atctaaaacc aatctactta       900
     ccagatttaa aagaaaatat gtctgaatgg caagtggcgc ttcaagaaaa cggttggaat       960
     agcttatatt ggaataatca tgaccaaccg cgtatcgttt ctcgttttgg gaatgacaat      1020
     cgtttccgtg ttcgttcagc gaaaatgctt gcaacttgtt tgcatatgat gaaaggaacg      1080
     ccatatattt atcaaggtga agaaattggg atgacgaatg ttcattttga aacgctagat      1140
     gattaccgtg atatcgaaac gctaaacatg tacaaagaac gcaaagagca agggcacagc      1200
     cacgaaagca tcatgcagtc gatttacaca aaaggccgtg acaatgcgag aacgccgtac      1260
     cagtgggata atagcgagaa tgctggcttc acaaccggaa cgccttggct taaagtcaac      1320
     ccgcgctata cagaaatcaa caacgaagaa gcgctgaaaa acccagattc cattttctac      1380
     tactaccaaa atcttattaa gttacgaaaa acgactgaaa tcatcacaac tggtaattat      1440
     cgtttgttat tacctaaaga tgaagcgatt ttcgcatatg aacgctacac agaaaatgaa      1500
     aaattagtgg ttttatgtaa tttcacagaa gaagaacaag ttatttctga tgaaaacatt      1560
     ttgaacgaaa tccaaaaagg ttccgtgctt gtaaacaatg ttcctaatat tatagaagga      1620
     actttacgac cttacgaagc aatcgtttat caaatcaagt aa                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page