(data stored in ACNUC10821 zone)

EMBL: AE017262.MALL-2

AE017262.MALL-2      Location/Qualifiers
FT   CDS_pept        279612..281309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL-2"
FT                   /locus_tag="LMOf2365_0270"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number="3.2.1.10"
FT                   /note="identified by similarity to SP:P21332; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03057"
FT                   /protein_id="AAT03057.1"
FT                   /translation="MEITETKEWWKESVVYQIYPRSFQDSNGDGIGDIRGIIERLPYLK
FT                   DLGINVIWLCPVYKSPMDDGGYDISDYYEIDPMFGTMSDMDELIEKAEKLGIKILMDLV
FT                   VNHTSDEHEWFEKAIADPKSKYRDYYIFREGVNGNPPNNWRSYFGGSAWEAVPGEENMF
FT                   YLHAFSKKQPDLNWENIVVRNECIQMINWWLEKGLGGFRIDAILNLKKRIEYGTFPADG
FT                   EDGLVFIGHWILNQPGIEEWLKEIDERTFKKHNAFTVAEADVPEERLSEFIGENGHFRM
FT                   VFDFSYTDIDTPETGEWFKNSEWTVKELKEKIITNELVTQRNGWGAKYLENHDQPRSIN
FT                   KYLPQEYQDDRSKKMLGTLFMMLHGTPFIYQGQEIGMSNTRMESIDDYNDIATHDQYHR
FT                   AILSGMSPEEALEGMYRRSRDNSRTPMQWNNQKNAGFSDSDEIWLKANPNYLDINVEQE
FT                   QIDDNSVLNFYKKLIHLRSDSSKYKEVAVYGELLPVESSDEVIAYKRKTDDAELLIIVN
FT                   FSDSENQLCIEGTYEQVLANVALPEMVENVLEIPAYTGAVFSRVLEVD"
     gtggaaataa cagaaacgaa agaatggtgg aaagaatcgg tagtgtacca aatctatccg        60
     cgtagttttc aagattcaaa tggggatggc attggagata ttagaggaat tatagaacga       120
     cttccttatt tgaaagattt aggtattaat gtgatttggc tttgtcctgt ctataaatca       180
     cctatggatg atggtggtta tgacatttct gattactatg agattgatcc aatgtttgga       240
     acgatgagtg atatggatga attaattgag aaggcagaaa aattaggaat aaaaatattg       300
     atggatttgg tggtaaacca tacatctgat gaacatgaat ggtttgaaaa agcaatagct       360
     gacccaaaaa gtaaatatcg agattattat attttccgag agggtgtaaa tggaaacccg       420
     cctaataatt ggcgttctta ttttggagga tctgcgtggg aagccgtacc aggtgaggaa       480
     aacatgtttt acctacatgc tttttctaaa aaacagccag atttaaactg ggaaaacatt       540
     gtagtgcgta atgaatgtat ccaaatgatt aactggtggc ttgaaaaagg tttaggtggc       600
     tttagaattg atgccatttt aaatttgaag aaaagaattg agtacggtac tttcccagcg       660
     gacggggaag atggcttggt tttcatcggt cattggattt taaatcagcc gggaattgaa       720
     gagtggctca aggagattga cgaacggaca tttaaaaaac ataatgcatt tactgtggct       780
     gaggcggatg tgcctgaaga aagactttct gaatttatag gtgaaaatgg tcatttccgt       840
     atggtgtttg attttagcta tacagatatt gatactcctg aaacaggcga atggttcaag       900
     aattcagaat ggacagtaaa agaattaaaa gagaaaataa ttaccaatga actggtgaca       960
     cagcgaaatg gttggggggc aaaatactta gaaaatcatg atcaaccgcg ttcgataaat      1020
     aagtatttac ctcaagaata ccaagatgat cgtagcaaaa aaatgctagg cacgttattt      1080
     atgatgttgc acggtacgcc gttcatttat caaggacaag agattggcat gagtaatact      1140
     cggatggaaa gtatagatga ttataacgat atcgcgacgc acgatcaata ccatcgcgca      1200
     attctctctg gaatgagtcc ggaagaagcg cttgaaggaa tgtatcggcg tagtagggat      1260
     aattcaagaa caccgatgca atggaataat caaaagaacg ctggtttttc cgactcagat      1320
     gaaatttggt tgaaagcaaa ccctaattac cttgatatta acgtagagca ggaacaaatc      1380
     gatgataatt ccgtattgaa tttttataag aaattaatcc atttaagaag tgattctagt      1440
     aaatataaag aagtggctgt ttatggagaa ttactgccag tagaatcaag tgatgaagtt      1500
     attgcttaca aacgtaaaac agatgacgct gagctcttaa tcatcgtgaa tttttctgat      1560
     tctgaaaatc aattatgcat tgaaggtact tatgaacagg tacttgctaa tgtagcgttg      1620
     ccagaaatgg tagaaaatgt ccttgaaata cctgcatata caggtgccgt cttctcaagg      1680
     gttttggagg tagactga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page