(data stored in ACNUC10821 zone)

EMBL: AE017262.MANL

AE017262.MANL        Location/Qualifiers
FT   CDS_pept        114281..115246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="LMOf2365_0113"
FT                   /product="PTS system, mannose-specific, IIAB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by similarity to GP:5669855; match to
FT                   protein family HMM PF03610; match to protein family HMM
FT                   PF03830; match to protein family HMM TIGR00824"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02901"
FT                   /protein_id="AAT02901.1"
FT                   /translation="MVGIILATHGEFAEGILQSGTMIFGEQENVKAITLMPSEGPEDIK
FT                   AKMEAAIASFDSQDEVLFLVDLWGGTPFNQANGLYELHKDKWAIVAGLNLPMLIEAFSS
FT                   RFTMESAHEIAANILAPAQEGVRVKPEELQPQVTATEQPQAEIAAVGDGKIEFVLTRVD
FT                   SRLLHGQVATAWTKATHPTRIIVVSDAVAKDDLRKKLIEQAAPPGVKANVIPVQKMIEI
FT                   SKDPRFGNTKALLLFENPQDVLRAIEGGVEIEQVNVGSMAHSVGKVVVSKVLSMGKDDV
FT                   ETFEKLKEKGVKFDVRKVPNDSSANMEDIIKKAKHELKTQ"
     atggtaggaa ttatcctcgc aactcacggt gaatttgctg aaggtatttt gcagtccgga        60
     acaatgattt tcggcgagca agaaaacgtt aaagcaatca ctttgatgcc aagcgaaggt       120
     ccagaagaca tcaaagctaa aatggaagct gcaattgcat cctttgatag ccaagatgaa       180
     gttttattct tagtggatct ttggggaggc acaccattca atcaagcaaa cggtctttat       240
     gaactacata aagataagtg ggcaatcgta gcaggactta atttgccaat gctgattgaa       300
     gctttctcat cacgttttac aatggaaagc gcacacgaaa tcgcagcaaa tattcttgca       360
     ccagctcaag aaggtgtccg cgttaaacca gaagaactac agccgcaagt aacagctact       420
     gaacagccac aagcagaaat cgctgcagtt ggtgatggaa aaatcgaatt cgttttaact       480
     cgtgttgatt cacgtctctt gcatggtcaa gtagccactg catggacaaa agcaacacac       540
     ccaacaagaa ttatcgtcgt ttcagatgca gttgcaaaag acgaccttcg taaaaaatta       600
     atcgaacaag cagcaccacc aggagtaaaa gctaacgtta tcccagtcca aaaaatgatt       660
     gagatttcaa aagatccgcg tttcggcaat acaaaagcac ttttattatt cgaaaatcct       720
     caagatgttt tacgcgcaat tgaaggtggc gtagaaatcg aacaagtaaa cgttggttcc       780
     atggctcact ctgtaggtaa agttgttgtt agcaaagtac tttccatggg gaaagatgat       840
     gttgaaacct ttgagaaact aaaagaaaaa ggcgttaaat tcgatgtgcg taaagtccct       900
     aatgactcaa gcgcaaacat ggaagacatc atcaaaaaag caaaacacga actaaagaca       960
     caataa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page