(data stored in ACNUC10821 zone)

EMBL: AE017262.METQ

AE017262.METQ        Location/Qualifiers
FT   CDS_pept        complement(324739..325560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="LMOf2365_0305"
FT                   /product="D-methionine ABC transporter,
FT                   D-methionine-binding protein"
FT                   /note="identified by similarity to SP:P28635; match to
FT                   protein family HMM PF03180; match to protein family HMM
FT                   TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03092"
FT                   /protein_id="AAT03092.1"
FT                   /translation="MRKLTKGLGILLASSLVLGLAACGGGSDDKALSTEKITIGTTAGP
FT                   HQQIAEEVQKLAKKDGLEIKIKTFDDYNTPNTALNDGDLDANNYQTIPFLEQQKKDKGY
FT                   KLDVAFKTVAFPMGIYSNDIKDLKNLKKGDKIAVPNDPSNEYRGLKLFEDAGVIKLKDG
FT                   VEEKATKKDIAENPLDLEIVELEASQIPAQLDEVAAAAINTNFAMGAGLSINKDAIYHE
FT                   PTKDNPYPNVFVVRSANKDDEVVKTLEKYYHSDEVKAFIEKEFNGSVVPAF"
     atgagaaaat taacaaaagg gttaggaatt ttacttgcat caagtcttgt tttaggatta        60
     gcagcatgtg gaggaggcag tgacgacaaa gccttaagca cagaaaaaat tacaattgga       120
     acaacagcag gacctcacca acaaatcgct gaagaagttc aaaaattagc gaaaaaagac       180
     ggtcttgaaa tcaaaatcaa aacatttgat gattataaca cgccaaatac agctttaaat       240
     gatggtgatt tggatgcgaa taactaccaa acaattccat ttttagagca acaaaagaaa       300
     gataaaggct acaaattaga cgttgctttt aaaacagtag cattcccaat gggcatttac       360
     tccaacgata ttaaagactt gaaaaatctt aaaaaaggcg acaaaattgc cgttccaaat       420
     gatccaagta acgaataccg tggtttaaaa ctgtttgaag atgctggcgt tattaaatta       480
     aaagatggtg tggaagaaaa agcaacgaaa aaagacattg ctgaaaaccc gcttgacctt       540
     gaaatcgttg aacttgaagc ttctcaaata cctgcacaat tagatgaagt tgcagccgca       600
     gctatcaata ctaactttgc aatgggcgct ggactttcta ttaataaaga tgccatttac       660
     cacgaaccta caaaagacaa tccatatcca aacgttttcg ttgttcgtag tgccaacaaa       720
     gacgatgaag tcgtaaaaac attagaaaaa tattaccatt cagatgaagt aaaagcattt       780
     attgaaaaag aatttaatgg gtctgtagta cctgcattct ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page