(data stored in ACNUC10821 zone)

EMBL: AE017262.MFD

AE017262.MFD         Location/Qualifiers
FT   CDS_pept        223056..226595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="LMOf2365_0225"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by similarity to SP:P37474; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF02559; match to
FT                   protein family HMM PF03461; match to protein family HMM
FT                   PF04851; match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03012"
FT                   /protein_id="AAT03012.1"
FT                   /translation="MKGLQQLIYEQKDIRAVLNALDEKEKAQLVTGLTGSSRALFASVV
FT                   EGASKRPVVFVTHNLYHAQKLYDDLLSLMDVDRLFLYPADELISSELSISSPELRGQRV
FT                   EALDFLLSGKPGIVIVPVAGLRKMLPPVSLWKHFNISIVEGEEIDPDVLRQKLVTMGYT
FT                   MSGMVNTPGEFSVRGGIIDIYPITEEFPIRIELFDTEVDSLRFFDVETQRSTTRVEEFR
FT                   LLPATEIILDQSYYPDIVKRLEKKMTHTLNELKENEDKQALVENLEEDLEMLRSGVKPD
FT                   MFFKYIGLAYPDPASLFDYFPKNTAILLDEFGRILETEESLEREEAEWQTETLSRMETV
FT                   RDVQVSHSFKKLLEANHSPKIYLSLFQKQMASMRVSKTTNIVYKQMQQFHGQMNVLKTE
FT                   LESWHKNNYAVVILAPNLERAEKMQQTLTDYDMESTILKKESDVPKYGMVQFVIGTFQN
FT                   GFELPLAKVAIISETELFNKKIKKVKKRQKLSNAERIQSYSELKVGDYVVHVNHGIARY
FT                   VGMETLDINGVHKDYLLLVYQGEDKLFIPVDQLDLVQKYVGAEGKSPRLNKLGGAEWKR
FT                   VKKKVQASVQDIADDLIKLYAEREAEKGYAFSADDEMQREFEEAFPYQETEDQLRSISE
FT                   IKKDMERPRPMDRLLVGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHFETMK
FT                   ERFQGFPIEIGLLSRFRTKKQQTETLKGMKNGTVDVVVGTHRLLSKDVEYQDLGLLIVD
FT                   EEQRFGVTHKEKIKQMRSKIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPANRFPVQT
FT                   YVAEQNNVLVREAIERELARDGQVYYLYNRVESITQKADEISAMVPDARVATAHGQMGE
FT                   SELESVILSFLEGEFDVLVTTTIIETGVDIPNVNTLFVQDADRMGLSQLYQLRGRVGRW
FT                   NRIAYAYFMYQKDKILREEAEKRLSAIKEFTELGSGFKIAMRDLSIRGAGNILGAQQHG
FT                   FIDSVGFDLYSQMLKEAIEAKKPKEEQKQIVPVEIDIQADAYIPEYYITDGRQKIEMYK
FT                   RFRNIETLSELEDLQSDMIDRFGEYPEEVEYLFTMTELKVHALEVGIESVKQEQNKITM
FT                   LFSESGTAGIRGDIVMQIIGEFGRMVGVGMEGTQLKITINVQNKPLKEWLYQVKSLAEK
FT                   LRGAMKERASAEN"
     ttgaaaggat tacaacaatt aatatatgaa caaaaagata ttcgagcggt cttaaatgcg        60
     ctggatgaaa aagaaaaagc acaacttgtc acagggctca caggttcttc acgtgcgtta       120
     tttgcaagcg tggtagaagg tgcgtcaaag cgtccggttg tatttgttac gcacaattta       180
     taccatgcgc aaaaattata tgatgattta ctttctttaa tggatgtcga tcgactattt       240
     ttatatccag cagatgaact gatttcttct gagttgagta tctctagccc ggaacttcgc       300
     ggtcaacgcg tggaagcgct cgacttctta ctatccggaa aaccggggat agtcattgtg       360
     ccagttgctg gtctcagaaa aatgcttcca ccagtatcgc tttggaaaca tttcaacata       420
     tccattgtag agggcgaaga aattgatcca gatgtactac gccaaaaact agtgacaatg       480
     ggctacacaa tgagcggaat ggtaaatacg ccgggagaat tcagtgttcg cggcgggatt       540
     attgatattt atccaattac agaagaattt ccaattagaa tagaactttt tgacaccgaa       600
     gtagattctc ttcgtttctt tgatgtggaa acgcagcgct cgacaacccg cgtggaagaa       660
     ttccgcctac tgcctgcaac tgaaatcatt ttagatcaaa gctattatcc ggatatcgtc       720
     aaacgcttag aaaagaaaat gacacatact ttaaatgaat tgaaagaaaa cgaggataaa       780
     caagcgctcg ttgaaaattt agaagaagat cttgaaatgc ttcgttctgg cgtgaaacca       840
     gacatgttct ttaaatatat cggtctggct tatcctgacc cagcctcgct ttttgattat       900
     tttccaaaaa acacggcaat tttgcttgat gaatttgggc ggattttaga aacggaagaa       960
     agcttggagc gggaagaagc ggagtggcaa acagaaacat taagtcgaat ggaaacggtt      1020
     cgcgacgtgc aagtaagtca ttctttcaaa aagctattag aagcaaatca ctcgccgaaa      1080
     atatacttat cccttttcca aaaacaaatg gcgagcatgc gcgtctcgaa aacaactaac      1140
     atcgtctata aacaaatgca gcaatttcat ggccaaatga atgtgttgaa aaccgagcta      1200
     gaaagttggc ataagaataa ttatgccgtt gttattttag ccccaaacct tgagcgcgcc      1260
     gaaaaaatgc aacaaacttt aactgactac gatatggaaa gtacgatttt gaaaaaagaa      1320
     tcggatgtgc cgaaatatgg aatggttcag tttgtcatcg gaacgttcca gaatggtttt      1380
     gaacttccat tagctaaagt agcgattata agtgaaaccg aactgttcaa taaaaaaatc      1440
     aaaaaagtga agaagcgcca aaagctctcg aatgcagaac gaatccaaag ttactctgaa      1500
     ttaaaagtag gtgactacgt ggttcatgtg aaccatggta tcgctcgtta tgttggcatg      1560
     gaaacgctag atatcaacgg tgtgcataaa gattacttgc tacttgttta ccaaggagag      1620
     gataaactat ttatccccgt cgatcaactt gatttagttc aaaaatatgt tggtgcagaa      1680
     ggtaaatcac caagattaaa caaacttggt ggcgctgaat ggaagcgagt gaagaagaaa      1740
     gtacaagctt ccgtccaaga tatcgcagac gatttaatca aactatacgc cgaacgtgaa      1800
     gctgaaaaag gctatgcgtt tagtgcggat gatgaaatgc agcgcgaatt tgaagaggct      1860
     ttcccgtatc aagaaaccga agaccaactg cgctcgattt cagaaatcaa aaaagatatg      1920
     gaacgaccgc gcccgatgga ccgtctgttg gttggagatg ttggttacgg aaagaccgaa      1980
     gtggccttac gagctgcttt caaagcaatt atggatggca agcaagtcgc cttcttagtt      2040
     ccgaccacca ttttagcgca acaacatttt gaaacaatga aagaacggtt ccaaggtttc      2100
     ccaatagaaa tcggactttt aagccgtttc cgaacaaaga aacaacaaac agaaacatta      2160
     aagggtatga aaaacggcac agtcgacgtt gttgttggta cccatcgttt attatcaaaa      2220
     gatgtggagt atcaagattt aggcttatta attgtcgatg aagaacaacg attcggcgta      2280
     actcataaag aaaaaatcaa acaaatgcgt tccaaaatag acgtactaac acttactgca      2340
     acaccaattc caagaacttt acacatgtcc atgctcggcg ttcgtgacct ctctgttatc      2400
     gaaactccgc cagcgaaccg ttttccagtg caaacatatg tggcggagca gaataacgtt      2460
     ttagttcggg aagcaattga acgtgaacta gcgcgcgacg gacaagttta ttatctatat      2520
     aatcgagtgg aatccattac gcaaaaagca gatgaaattt ctgcgatggt tcctgatgct      2580
     agggttgcca ctgcgcacgg acagatgggt gaatcggaat tagagtctgt tattttaagt      2640
     ttccttgaag gggaattcga tgtacttgta acgacgacca tcattgaaac cggcgtagac      2700
     attccaaacg ttaatacact ctttgttcaa gatgctgatc ggatgggtct ttcacaactt      2760
     tatcagttgc gcggacgagt agggcgttgg aacagaatcg cctacgctta cttcatgtat      2820
     caaaaagata aaatattgcg tgaggaagcg gagaaacgct tatcggctat taaagaattc      2880
     actgaattag gttcaggttt caaaatagcg atgcgtgact tatctattcg tggtgccggt      2940
     aatatcctcg gagcgcaaca acatggcttt atcgattcag tcgggtttga tctctactcg      3000
     caaatgctta aggaagcaat tgaggcgaaa aagccaaaag aagaacaaaa acaaattgtc      3060
     cctgttgaaa ttgatatcca agcagacgcc tatattccgg aatattacat tacagacggc      3120
     cgccagaaaa tcgagatgta caaacgcttc cgcaatattg aaacgttaag cgaactcgaa      3180
     gatttacaaa gcgatatgat tgaccgtttt ggtgaatatc cagaagaagt agaatatcta      3240
     ttcacaatga cagaactcaa agtccatgca ctcgaagttg gcattgagtc cgtcaaacaa      3300
     gaacaaaata aaattaccat gctattttca gaaagcggaa cagcaggcat tcgcggagat      3360
     atcgtcatgc aaatcattgg cgaatttggc cgaatggtcg gtgtgggtat ggaaggtaca      3420
     caactaaaaa tcacgataaa cgtccaaaat aaacctttaa aagaatggtt ataccaagtc      3480
     aaaagtttgg ctgaaaaact tcgcggagcc atgaaagaaa gagcatctgc agaaaattga      3540
//

If you have problems or comments...

PBIL Back to PBIL home page