(data stored in ACNUC10821 zone)

EMBL: AE017262.MOTB

AE017262.MOTB        Location/Qualifiers
FT   CDS_pept        734956..735783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="LMOf2365_0722"
FT                   /product="chemotaxis protein MotB"
FT                   /note="identified by similarity to SP:P28612; match to
FT                   protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03503"
FT                   /protein_id="AAT03503.1"
FT                   /translation="MAKRRKKPQEEHVDETWLIPYSDLLTLLLALFIVLFASSSVDAKK
FT                   FEQMGNAFKKIVEEGAAGNQAYVSKEKGPDDPNVNAVLKAMEEQDKKKEATEQEKAKKA
FT                   AAALLKKQNEEKIEAFKKQIDSYIAAEHLGAKMTTKYSDEGLLITIRDDILFQSGSAEL
FT                   TAGKREIAKEIGELFAQGKGTMEGIVSGHTDNVPISTSIYSSNWELSVARAVNFMEAII
FT                   QENSEVNPGEFSARGYGEFRPVAKNDIAANREKNRRVEIMVRPINRDTLDEDE"
     gtggccaagc gtcgcaagaa accgcaggag gaacacgttg atgaaacgtg gttaattcca        60
     tatagtgatt tgctgacact tttacttgcg ctattcatcg ttctgtttgc ctccagttcc       120
     gttgatgcta agaagtttga acaaatggga aatgcattta agaaaattgt agaggaaggc       180
     gcggcaggca atcaagcata tgtatccaaa gaaaaaggac cagatgatcc taatgtgaat       240
     gcagtcttga aggcgatgga agagcaagat aaaaagaaag aagcaaccga acaagagaaa       300
     gccaaaaaag cagcagcggc cttacttaaa aagcaaaacg aagaaaagat tgaagccttt       360
     aaaaaacaaa ttgatagtta tattgcagca gaacatttgg gagcaaaaat gacaacgaaa       420
     tactcggatg aagggctttt gataactatc cgtgatgata ttttattcca gtcgggaagt       480
     gcagaattaa ctgcaggaaa acgcgagatt gccaaagaaa tcggcgaact ttttgcgcaa       540
     ggaaaaggaa cgatggaagg gattgtttct ggacataccg ataatgtgcc aataagcacc       600
     tcaatttact cttccaactg ggaattaagt gtcgcgcgcg ccgttaattt catggaagca       660
     atcattcaag aaaatagcga agtaaaccca ggcgagttca gtgctcgcgg ctacggagaa       720
     ttcagacctg tcgccaaaaa tgatatcgca gcaaatcgcg aaaaaaatcg gcgtgtagaa       780
     atcatggtac gcccaattaa tcgcgatacg ctagatgaag atgagtag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page