(data stored in ACNUC10821 zone)

EMBL: AE017262.NRDD

AE017262.NRDD        Location/Qualifiers
FT   CDS_pept        318506..320656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="LMOf2365_0299"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by similarity to GP:4098081; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF03477; match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03086"
FT                   /protein_id="AAT03086.1"
FT                   /translation="MYVEQLNEQMVIKRDGRKANFDLIKIRNAVEASMKAINLEDETFL
FT                   EEILLEVVSELPNKADMTIDEIQHCVENTLMKSTYPDVARAYIEYRHDRDHERENITDM
FT                   HKSVEKLLQKDKTVVNENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHLKGE
FT                   IHFHDLDYSPYHAMTNCCLIDIEGMLSKGFTIGNANVESPKSIQTATAQIAQIIANVAS
FT                   SQYGGCSVDRIDEVLSVYARLNFEKHKKDAMEWVVPEKQEGYAAEKTRKDIYDAMQSLE
FT                   YEINTLYTSNGQTPFVTLGFGLGEDWFAREIQKAILKVRIGGVGKDKHTAIFPKLVFSI
FT                   RRGTNLNAEDPNYDIKQLALECSSKRMYPDVLNYDSLVRLTGDFKVPMGCRSFLPAWEN
FT                   ENGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHERMKTVKDALLFRLNRVRQA
FT                   RPENAPILYKYGAFGKRLQDGENVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDKE
FT                   AKNFTLDILKELKGYADNWKDEYGYWFSVYSTPSESLTDRFNRLDKEKYGVIKDITDKD
FT                   YYQNSFHYDVRKKITPFEKIDFEKDYPEFCSGGFIHYCEYPKMVHNTKALEAVWDYSYD
FT                   RVAYLGTNTPIDKCYECNFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKR
FT                   PMVHGRHVEISNRVKHMENLGE"
     atgtacgtgg aacaacttaa tgaacaaatg gtaataaaaa gggacggccg taaagcaaac        60
     tttgatttaa ttaaaattcg taatgccgtt gaagcatcta tgaaagcaat taatttagag       120
     gacgagactt tcttagaaga gattttgctt gaggttgtaa gtgaattacc taacaaggca       180
     gatatgacca tcgatgaaat ccagcattgc gtcgaaaata ctttaatgaa atcgacgtat       240
     cctgatgtag cgagggctta catagaatac cgccatgatc gcgaccatga gcgtgaaaac       300
     atcacagata tgcacaaaag cgtagaaaag ctactacaaa aagacaaaac agtagtaaac       360
     gaaaatgcca acaaagacgc gactgtcttt aatacgcaac gcgatttgac agcaggagcc       420
     gtagcaaaaa gttacgcatt aaaatacatg ctaccaaaac acgtatccaa cgctcattta       480
     aaaggggaaa ttcattttca cgatttagat tacagcccat accatgcgat gaccaactgt       540
     tgtttaatcg acatcgaagg aatgctgtca aaaggattta cgattggtaa tgccaacgta       600
     gaaagcccga aatctatcca aactgctacc gcacaaattg ctcaaataat cgcaaacgta       660
     gcaagttcac agtacggcgg ctgttcggtt gaccgtattg atgaagtttt atccgtttac       720
     gcgcgtttga actttgaaaa acataaaaaa gatgcgatgg aatgggtcgt tccagaaaaa       780
     caagaaggtt atgcagcgga gaaaacacgc aaagatattt acgatgcgat gcaaagctta       840
     gaatacgaaa tcaacacatt atatacaagt aacggccaaa cacctttcgt aacactaggc       900
     ttcggtcttg gtgaagattg gtttgcccgt gaaattcaaa aagccatcct aaaagtgcgt       960
     attggtgggg ttggtaaaga taaacacacg gctattttcc cgaaattagt attttcaatt      1020
     cgccgtggaa ctaatttaaa tgcagaagat cctaattatg acattaaaca attggcgcta      1080
     gagtgttcct cgaaacggat gtatccagat gtactcaact acgattcact cgttcgctta      1140
     acaggcgatt tcaaagtacc aatgggctgt cgttcgttct tgccagcttg ggaaaacgaa      1200
     aacggcgaac acgtgaacgc gggaagaaac aatcttggtg ttgtaacact taacattcca      1260
     cgtatcgcta tccaaagtgg tggggacaaa gaacgtttct gggaaatttt ccacgaacgc      1320
     atgaaaacag tcaaagatgc gctacttttc cgtttaaacc gcgtacgtca agcacgtcca      1380
     gaaaatgcac caattttata taaatacgga gcatttggca aacgactaca agatggcgaa      1440
     aatgttgatc aacttttcaa taaagaacgt tctactatct ctatcggcta tatcggtctt      1500
     tatgaagcag cgactgtatt ttacggcggt gaatgggaag gcgacaaaga agcaaaaaac      1560
     ttcacgcttg atatcttgaa agaactaaaa ggttatgcgg acaactggaa agatgaatat      1620
     ggctactggt ttagcgtata ttcgactcca agtgaaagct taactgaccg ttttaaccgt      1680
     ttagacaaag aaaaatatgg tgtaattaaa gacatcacag ataaagacta ctaccaaaac      1740
     tctttccact atgatgttcg taaaaaaatt accccatttg aaaaaattga ttttgaaaaa      1800
     gattatccag aattttgctc tggcggattc attcattatt gtgaatatcc aaaaatggtt      1860
     cacaatacga aagcacttga ggctgtatgg gattactcct atgatcgtgt agcttacctt      1920
     ggtacaaata caccaatcga taaatgttac gaatgtaatt ttgaaggtga atttgttcct      1980
     acagaagaag gcttcaaatg cccaagctgt ggcaacaccg accccgaaaa agcagatgtt      2040
     gtaaaacgta cttgtggcta tttaggcaac ccaatgaaac gtccaatggt tcatggacgt      2100
     cacgtagaaa ttagcaatcg cgtgaaacat atggagaact taggtgaata a               2151
//

If you have problems or comments...

PBIL Back to PBIL home page