(data stored in ACNUC10821 zone)

EMBL: AE017262.OGT-1

AE017262.OGT-1       Location/Qualifiers
FT   CDS_pept        complement(614786..615082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt-1"
FT                   /locus_tag="LMOf2365_0600"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by similarity to SP:P37429; match to
FT                   protein family HMM PF01035; match to protein family HMM
FT                   TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03382"
FT                   /protein_id="AAT03382.1"
FT                   /translation="MIPADFEDRVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATL
FT                   KHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSEGVTFKENGHVKMKDHFWQ"
     atgattccag cagattttga agaccgtgtt tatacagtcg tgcgccaaat accgcgcggt        60
     aaagtgacta catatggcca aatcgcctat atgattggct ttcctaaaaa cgccagactc       120
     gtaggtgcta cgctaaaaca ttcgaagcgt gaccaaatta cgccttgcca tcgtgtcgtc       180
     aatgcagctg gtcgacttgt ccccggttgg gaagagcaac gcgaactcct tttatcagaa       240
     ggtgtgacat ttaaagagaa tggacacgtc aaaatgaaag atcatttttg gcaataa          297
//

If you have problems or comments...

PBIL Back to PBIL home page