(data stored in ACNUC10821 zone)

EMBL: AE017262.PE100

AE017262.PE100       Location/Qualifiers
FT   CDS_pept        98267..98956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0129"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02890"
FT                   /protein_id="AAT02890.1"
FT                   /translation="MKYIDYHDYMHKDAIIYAYLQNNFPYIRKRIKAWESFTLDREDIL
FT                   LVKSGAIFEEISGKKKGIARCFFSKSLIFPTRNQIVLKAFETSEICFINAETAFGKLEK
FT                   DQILSNFFLQIAEKNEEDMRRQAFLGTENSKNKIISTLNFLLENNKSNNKTPIFPEWLQ
FT                   INVLAQLANCSISTISSTVNELHAEGILDIKSSPWKLKGREKRIEILENEHQKIKLNER
FT                   KHKSNVF"
     atgaagtata tcgattacca tgattatatg cataaagacg cgataatata tgcttatctc        60
     caaaataatt ttccgtatat ccgcaaacga ataaaggcgt gggaaagttt tacgctagat       120
     cgagaagata ttctattggt gaaaagtggc gcaatatttg aagaaattag tgggaagaaa       180
     aaaggcatag cacgatgctt tttttcgaaa agtttaattt ttcctactag aaatcaaata       240
     gtattgaaag ctttcgaaac ttcagaaatt tgttttatca atgctgaaac agcttttggg       300
     aaattagaaa aagatcagat tttatccaat ttttttctac agattgcgga gaaaaacgaa       360
     gaagacatgc gaagacaagc atttcttggg acagagaact caaaaaataa aattatttca       420
     acgctcaact tcttgctaga aaataataaa tctaataata aaacacccat ctttcctgaa       480
     tggcttcaaa taaatgtttt ggcacagtta gcgaattgtt ccatctctac catttcttct       540
     actgtaaacg aattacatgc ggaaggaata ttagatataa aatcttcgcc ctggaaactt       600
     aaaggcagag aaaagaggat agaaattctt gaaaatgagc accagaaaat aaagcttaat       660
     gaaagaaagc ataagagtaa tgttttctaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page