(data stored in ACNUC10821 zone)

EMBL: AE017262.PE102

AE017262.PE102       Location/Qualifiers
FT   CDS_pept        104909..107218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0131"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02892"
FT                   /protein_id="AAT02892.1"
FT                   /translation="MKPTWKIGIIVAAVPLIIIAVVLWGSFKEARYNLVSLPDDGVVLN
FT                   NEQETLQFQKGNTLYRSWNSDQLIAKNDKEDTRNEIMESTILYLNKEALMFTKSVPVID
FT                   TNGVSSKLKGRQVYQQTNSSYKYKNSEITENSIVKLANRQYYLNADATLYLGGKEIKKV
FT                   SKPLLLIDKTGSVTIYENKKKSRFLGHMTLKVNDKTVLDASNETYTVGERKIDLASFGG
FT                   TDNEKIVVKEDKKKTAESAKEKESAKKTASNSSQSENESNQTTKGTGNQLNATKKYGNN
FT                   LNVGNGTSDSEPNDGKDTKNNGSGSNANGGTNQSDLNEIDNYEAILRKIEDLNKKLERN
FT                   IPVLRIGYIAPGVTSVKVNYNYVDPNNTLIGVTKISAVDEKTGKTVNTQYVSAVDTEAT
FT                   LKGLSPNGKYHLEFTYQYDLGTNKGIQEVKMQSDSFTTQTVAAIYQMQSVTSTTMKVNI
FT                   ALDAQIDDVKRARIKVTKADGDFFYMNVSANFLNGNGETLNVTGLSPKTAYQFQTIIEM
FT                   KNGETIELNSSEKYYTMQATVLRNLRASQSVNKVLQVQYDWSSADYTLNQATIELEDEE
FT                   DKTEVDYQIVNQEKGNIHLVPDTKRELINLKAKLVLKTTNNNTKESKTFEYPVKQEIEY
FT                   DKQAKLTMDLTPFQTEENSELQSEKQDVVAEKETNGNDLTAKMEDVLAPQNATYDMSFS
FT                   MQRKALETYQLEFERKIAGIDDDNWTVWKSQQVTTDEAGQVKVTETISKLAKESFDYRV
FT                   AVYDAQGALQLYVYQK"
     atgaaaccta catggaaaat agggataatc gttgcagctg ttccgttaat aattattgct        60
     gtcgtcttat gggggtcttt taaggaggca aggtataatc ttgtctctct ccctgatgac       120
     ggtgtagtcc taaataatga gcaagagaca ttgcaatttc aaaagggcaa tacgctttat       180
     cgcagttgga atagtgatca attaattgcg aaaaacgata aagaagatac tcgaaacgaa       240
     attatggaga gtaccatcct ttatctaaat aaagaagcct taatgtttac taagagtgtt       300
     cccgtcattg atacaaatgg ggttagtagc aaactaaaag gaagacaagt ctaccaacag       360
     accaattctt cctataaata caaaaactca gaaatcacgg aaaacagtat tgtaaaacta       420
     gcaaaccgtc aatactattt aaacgcagat gcaacacttt atcttggcgg caaagaaatc       480
     aaaaaagtgt cgaaaccatt acttttgatt gataaaacag gaagcgtcac tatttatgaa       540
     aacaaaaaga aaagccgttt tcttggtcat atgaccttga aagtcaatga taaaacggtt       600
     ttagatgcta gtaacgaaac gtatactgtc ggcgaacgga aaattgattt agctagcttt       660
     ggtggaacag acaatgaaaa gatagtcgta aaagaagata agaaaaagac cgcagaatct       720
     gcgaaagaaa aagagtctgc gaagaaaaca gcaagtaact cctctcaatc agaaaatgaa       780
     agtaaccaaa caacaaaagg tacaggcaat caactcaatg ctaccaaaaa atacggaaat       840
     aatttaaatg ttggaaatgg aacttctgat tcggaaccaa acgatggtaa ggatactaaa       900
     aataatggtt caggaagtaa tgcgaatggt ggtactaatc aatcagattt aaatgaaatt       960
     gataattatg aagcaatctt acgtaaaata gaggacttaa ataaaaaatt agagcgaaac      1020
     attccagtgc taagaatcgg ctatatcgca cctggagtga ctagcgtgaa agtcaactat      1080
     aactatgtag atccgaataa cactttaatt ggtgtcacta aaattagcgc cgtagatgaa      1140
     aaaactggaa aaacagttaa tacgcaatat gtttcagcag tagatacgga agctacacta      1200
     aaaggacttt cgccaaatgg caagtatcat cttgaattta cctatcaata tgatttagga      1260
     acaaataaag gcattcagga agttaaaatg caaagcgact cttttacaac gcaaactgtt      1320
     gccgcaattt atcaaatgca aagcgttaca agcacaacaa tgaaagtaaa tatagcgctt      1380
     gatgcacaaa ttgatgatgt taaacgagca agaattaaag taaccaaagc agatggagat      1440
     tttttctata tgaatgttag tgcgaatttt ttaaatggta acggagaaac gcttaatgta      1500
     actgggctaa gtcctaaaac tgcttaccaa ttccaaacga ttattgaaat gaaaaacgga      1560
     gaaaccattg aattaaacag ctccgagaaa tattacacta tgcaagcaac tgtactaaga      1620
     aatctaagag ctagtcaatc tgtgaataaa gttttacaag tgcaatatga ttggagttcg      1680
     gctgattata cattaaatca agcaaccatc gaactggaag acgaggaaga taaaacagaa      1740
     gtagattatc aaatcgttaa tcaagaaaaa ggtaatattc atcttgttcc agacacgaaa      1800
     agggagttaa tcaacttaaa agccaaacta gtactcaaaa cgacaaataa taacacaaaa      1860
     gaaagcaaaa catttgagta tcctgttaag caagaaattg aatacgacaa acaagctaaa      1920
     ctaacaatgg acttaacgcc gtttcaaact gaagaaaaca gtgagttaca gtctgaaaaa      1980
     caagatgtag tagcagagaa agaaacgaac ggaaatgatt taacagctaa gatggaagat      2040
     gttttagccc ctcaaaacgc aacttatgat atgtcctttt cgatgcaacg taaagctctc      2100
     gaaacgtatc agttggaatt tgaaaggaag atagctggga tagacgatga taattggacc      2160
     gtgtggaaga gtcaacaagt tacaacggat gaagcagggc aagtgaaggt tacagaaacc      2220
     atttcaaaac tagctaaaga aagcttcgat tatcgtgtag ctgtatacga tgcgcaaggt      2280
     gcattacaac tgtacgttta tcaaaagtag                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page