(data stored in ACNUC10821 zone)

EMBL: AE017262.PE106

AE017262.PE106       Location/Qualifiers
FT   CDS_pept        110050..110919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0108"
FT                   /product="putative ATP synthase F1, gamma subunit"
FT                   /note="identified by match to protein family HMM PF00231"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02896"
FT                   /protein_id="AAT02896.1"
FT                   /translation="MSSIDQARKTIKALNSTYKIVHVTELATLGKLSALREKAEAAVSY
FT                   YETILKSLRWVRKTMYTSNNQVKEEKNVTAIAITSERGLCGAYNSEVFVEIDQLIESLG
FT                   EQVTINWVVVGEQGHRYLTKLGQNITSYLQFSLENIDLETTTAVTADFIDLIHSEQMDA
FT                   LYVIFTKYLNAVQSEAMCEKIYPEIPEDSNTEEIEVDYVLDFETDDEQVEQLLLENYLC
FT                   GLLYSMFRYSVASEYCMRRIAMKQAKDNIQKQLEEAIFNARKQALQQKTGELLDIISGA
FT                   QTIRKDEE"
     ttgagtagca tagaccaagc ccgaaaaacc attaaagcac taaattcaac ctataaaata        60
     gtccatgtaa cagaactagc gacactcgga aaactttccg ccttaagaga aaaagcggaa       120
     gcggctgtta gttattacga aactatttta aaaagtttgc gctgggtgag aaaaactatg       180
     tacaccagta ataaccaagt aaaagaagaa aaaaatgtta ctgctattgc gataacttct       240
     gagcgtggtc tttgcggcgc ctataatagt gaggtttttg ttgaaatcga ccagttgatt       300
     gaatcactcg gcgagcaagt aacgataaat tgggtagttg taggtgaaca aggtcaccgt       360
     tatttaacaa aactaggtca gaatatcacc tcttatttac agttttctct tgaaaatatt       420
     gatttagaaa ccactacggc tgttactgct gattttattg acctaattca ttcggaacaa       480
     atggacgcac tatatgtgat tttcacgaaa tatttgaatg cagttcaatc agaagctatg       540
     tgtgaaaaaa tttatcctga aattccagaa gactcgaata cggaggaaat tgaagtagat       600
     tatgtactcg atttcgagac ggatgatgag caggtggagc agttattatt agaaaactat       660
     ttgtgtggct tgctttatag catgtttcgt tactcggttg ccagtgaata ttgcatgcgc       720
     cgaatcgcga tgaaacaagc caaagacaat atccagaaac aattggaaga agctattttt       780
     aatgccagaa agcaagcatt acaacaaaaa actggcgaat tactcgatat cattagtgga       840
     gcacagacga ttaggaagga cgaagaataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page