(data stored in ACNUC10821 zone)

EMBL: AE017262.PE108

AE017262.PE108       Location/Qualifiers
FT   CDS_pept        112303..112635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0110"
FT                   /product="putative ATP synthase F1, epsilon subunit"
FT                   /note="identified by match to protein family HMM PF02823"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02898"
FT                   /protein_id="AAT02898.1"
FT                   /translation="MKLKIVSPMGQFFEGEVEGFVINTKEGQQTVLEEHIDCLSFFDYS
FT                   EISILDAVASDPIFVALGYLHLVQNEANIMAQFASTDAEQAERIFERLNKRKQTESRRS
FT                   DDKRIF"
     atgaaactta aaatcgtctc gcctatgggg cagttttttg aaggagaagt agagggcttt        60
     gttattaata caaaagaagg acaacaaacc gtgttagaag agcatattga ttgtttaagc       120
     ttttttgact atagtgaaat cagtatttta gatgcagttg cttcggaccc aatctttgtg       180
     gcacttggat atttacattt agtacaaaat gaagcaaata tcatggcaca gtttgcttct       240
     acggatgccg agcaagcgga gcggattttt gaaagactaa acaagcgaaa acaaacagag       300
     agtaggcggt ccgatgacaa gcgaattttt tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page